CAZyme Information: ZTRI_3.871.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.871.mRNA-p1
• CAZy Family: GH37
• CAZyme Description: similar to beta-glucosidase g

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	Ztri_chr_3|CGC13	90170.18	4.6558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:2730663-2733773(-)

Full Sequence      

MGRSTEKLRVAATLLMCLAPVNGQDPLTEAGPAWNHADYETSPPVYPSPQMSGAGWEIAL
EKAKAWVSQLTTDEKSLLVTGTEGPCVGNIAPIPRLNFTGLCLQDGPLSLRQADYASVFP
AGISVAAAWDRKLAYKRGYQLGAEYKAKGAHVVLGPVAGPLGRSGYAGRNWEGFSPEPYL
TGVFMSETIEGHQDAGVQACAKHYVGNEQETQRNPSINPETNQTIEALSANIDDRTLHEL
YNWPFANAVKSGVASIMCSYQRLNGSYGCQNSKILNGVLKEEMGFQGWVVSDWMATHAGH
QAADAGLDMNMPGGLVFSQSVPSFWGKNLTTSVENGSLALTRLDDMAHRVMAPYFHLNQD
VNFPNVDGSSPGLQKTWAQSTYRYNFTYGPKSTDVRANHKELIRELGAAGTVLLKNVNKT
LPLKNPKNIAVYGNDAGDITNGLYFANLISNTGFEYGVLPTAGGSGTGRFTYVVPPLDAI
KAKVDEDALVQYLLNNTQIIGGQQQGPTGFVGLTPDSSGLIYPEPEVCLVFVKTWASEGY
DRTTLRFDWNGTEVVETVALSCPNTIVITHSSGLNVLPFADNENVTAIIAAHLPGQEVGN
SIVDILWGDVNPSGKLPYTIAHEEEDYAFADITNSTELLETTDPNAWQQDFTERLLIDYR
HFDYENKSVAYEFGFGLSYTTFEVADASVEKIVDGEIAPTAAPAAIVPGGNPGLWETLYK
ITVKVTNTGDLAGATVPQLYLGLPQIKNEATTPPKVLRGFEKVYLEPGQSQEVEFELQRR
DISYWDVVAQDWVIDPATINVHVGLSSRDIHTTSSFEPLGPTAYRPRRM

Enzyme Prediction     

EC	3.2.1.-:5	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	92	312	5.1e-59	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	8.85e-55	411	679	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.01e-47	111	442	75	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.30e-46	117	819	118	765	beta-glucosidase BglX.
395747	Glyco_hydro_3	6.34e-34	116	350	85	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	5.84e-30	62	775	52	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ49196.1|GH3	0.0	1	829	1	829
SMR49019.1|GH3	0.0	1	829	1	829
SMR50196.1|GH3	0.0	1	829	1	829
SMY22896.1|GH3	0.0	55	829	34	808
USW52149.1|GH3	0.0	1	829	1	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NBS_A	3.35e-202	25	810	3	850	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
6SZ6_A	2.74e-195	39	810	1	829	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5JU6_A	5.83e-194	30	818	13	853	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
4IIB_A	2.83e-193	42	810	6	831	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJJ_A	1.64e-192	38	815	3	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U325|BGLG_ASPOR	2.44e-316	39	819	47	813	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|B8NMR5|BGLG_ASPFN	2.44e-316	39	819	47	813	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q5B0F4|BGLG_EMENI	6.96e-312	39	819	48	817	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|Q0CUC1|BGLG_ASPTN	3.19e-297	39	819	47	813	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1
sp|A1DC16|BGLG_NEOFI	3.67e-296	39	819	47	813	Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000379	0.999567	CS pos: 23-24. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_3.871.mRNA-p1.