CAZyme Information: ZTRI_3.812.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.812.mRNA-p1
• CAZy Family: GH35
• CAZyme Description: similar to initiation-specific alpha-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	Ztri_chr_3|CGC11	45365.60	6.6945

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:2560913-2562166(+)

Full Sequence      

MLTFRRALLVAAVVLTCFLFLRNSHPSQTNAYKPSNSPKPTGSYIDNRKIVEASPKPAEH
ASEEHPKPVISQQKEESHIALSDKKVRPQIPLADLKAKTLRQQLAYAFPYDVEAKFPAYV
WQTWKTTPASGAFPEEWRAAEASWTQLHPDFVHEVITDSVAVNMVRHFYASLPEVQEAYA
ALPAPVLKADFFRYLILLARGGIYSDIDTTALKSAVEWVPTEVSRETYGLVIGIEADPDR
EDWHEWYSRRIQFCQWTIQSKPGHPVLLDIVAAITEETLRRKRAGEFSSRHMKKVMKDVV
EFTGPALWTDIVFKFFNNPDYFDMSTSKGNITWRQFTGITQAKKVGDVVVLPITSFSPGV
QQMGAMDIDDPMAFVHHKFDGSWKPENLRHIGEQTENDD

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	136	221	1.8e-20	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.68e-49	98	384	64	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.85e-21	134	224	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR50137.1|GT32	3.68e-274	1	399	1	399
SMY22836.1|GT32	3.68e-274	1	399	1	399
SMR48951.1|GT32	3.02e-273	1	399	1	399
SMQ49134.1|GT32	3.02e-273	1	399	1	399
UJO17553.1|GT32	3.31e-212	1	396	1	397

PDB Hits     

ZTRI_3.812.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.27e-96	99	388	82	380	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.26e-73	106	386	132	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	4.24e-73	100	392	80	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.95e-72	99	384	113	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UT67|IMT2_SCHPO	3.11e-09	113	208	79	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.965824	0.034196

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_3.812.mRNA-p1.