CAZyme Information: ZTRI_3.552.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.552.mRNA-p1
• CAZy Family: GH31
• CAZyme Description: similar to glycoside hydrolase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		31640.43	6.2247

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:1812934-1813906(+)

Full Sequence      

MRFSAVITALAASAPLTTAFYRGFNMAGNNEDGSCKTTAQWTEAFNKLKGLPQPITSVRL
FASSDCNTLDNAVPAALNTGTKLLVGLWTQNEDHFTAEKHALESNIKAHGSDWILACAAG
SEDIYRGGLDINRLAEQIYDVRGMIRALGSNAPVGHVDTWNAWVNPGTDVVTKACDFVGM
DAYPYWQGARIEDAHDVFMKTLKDTRDHVNSVKNGIPVWVTETGWPVSGPNFGASVASKT
NAQKFWRGTGCKLFNQVDVFWYSYQDYNASPSFGIFDKNGKANYDLSPC

Enzyme Prediction     

No EC number prediction in ZTRI_3.552.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	53	286	6.5e-22	0.909967845659164

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.43e-53	12	279	36	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	9.18e-12	23	286	2	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ48864.1|GH17	1.23e-221	1	289	1	289
SMR48682.1|GH17	1.23e-221	1	289	1	289
SMY22563.1|GH17	1.23e-221	1	289	1	289
SMR49866.1|GH17	1.23e-221	1	289	1	289
UJO17243.1|GH17	5.05e-136	1	289	1	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	7.95e-30	20	263	37	265	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.85e-29	20	263	37	265	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	4.00e-50	1	275	1	295	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	4.34e-50	1	275	1	295	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	1.72e-49	7	275	6	296	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	2.34e-49	1	275	1	295	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|O13990|BGL2_SCHPO	1.11e-47	12	287	32	317	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999730	CS pos: 19-20. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_3.552.mRNA-p1.