CAZyme Information: ZTRI_3.403.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.403.mRNA-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239		26385.29	9.7169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:1374340-1375231(+)

Full Sequence      

MSAALEIITLKGRYFWRGDKRFLVRGVVYQLVNEEWQMTASTLFRMSDYHDYKPTYHCSR
SSGSIRSLHSHDRAMKLLEEAGIYVLVAATTPRKCIRRNDPPASYTASLLQHYFKTLDVM
SQYKNTLGVLAANVLVNNHASEACVPVIAAVVRGMKQYMRLKADATGQRILPVGYAAAAS
DDRNLALENSLPGFSPKSWSSESKSFGSKSSASAISQAVDVDVGLLLLGEVNVARCKTL

Enzyme Prediction     

EC	2.4.1.-:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	3	184	8.2e-32	0.5961538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.22e-36	3	187	7	194	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY22413.1|GH72	1.21e-89	1	187	1	213
SMR49715.1|GH72	4.87e-65	1	187	1	121
UJO14313.1|GH72	7.01e-35	8	187	10	198
SMQ48714.1|GH72	1.81e-32	120	187	1	68
CAE7022949.1|GH72	1.34e-31	8	184	10	187

PDB Hits     

ZTRI_3.403.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XT72|GEL1_ASPFC	5.53e-23	8	187	32	209	1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel1 PE=1 SV=1
sp|P0C7S9|GEL1_ASPFU	6.90e-22	8	187	32	209	1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel1 PE=3 SV=1
sp|Q08193|GAS5_YEAST	1.86e-18	2	188	24	211	1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS5 PE=1 SV=1
sp|O13692|GAS5_SCHPO	1.91e-16	2	178	23	199	1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas5 PE=1 SV=1
sp|Q9Y7Y7|GAS4_SCHPO	2.35e-16	2	187	22	205	1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_3.403.mRNA-p1.