CAZyme Information: ZTRI_3.1100.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.1100.mRNA-p1
• CAZy Family: GT59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		39172.68	6.1203

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:3343603-3344676(+)

Full Sequence      

MSADMDQLQGMQAKAKSMASAVAASLPEAIPWSKSYHLPTDLKNYARLRIVRVVAAGVVM
LWCASVFGLFASATKVKISLPSLVDGDVLDRNSTERLPLIPPNIYQIFLGWEPDKAKDYS
DNILSWIGKSPSYSYTLLDDEGAQSIVSKLAESSTHAHILPVFYAMGRRVMRVDFLRYLL
LALEGGVYSDIDTELLKPVHDWVPKALQNSTRLIVGIEADHSPPIAGTTYETQFCQWTLA
GAPGHPVLWRMVDKVLDTIRTRPFSAHSVDYSNDEVLGIGGPAGWTETIYEYLSDEAGEP
VTWRNLTGMTEPKLFGDVLVLPIDGFASNVGHSGSHGDQAPGAMVKHHFKGSWRGGN

Enzyme Prediction     

No EC number prediction in ZTRI_3.1100.mRNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.34e-26	98	353	80	344	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.33e-09	120	204	5	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR49258.1|GT32	1.12e-265	1	357	1	357
SMY23127.1|GT32	1.12e-265	1	357	1	357
SMQ49434.1|GT32	1.12e-265	1	357	1	357
SMR50432.1|GT32	3.21e-265	1	357	1	357
ANH56603.1|GT32	2.58e-78	93	356	85	343

PDB Hits     

ZTRI_3.1100.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.40e-52	126	354	165	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	6.40e-39	82	354	76	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.39e-29	107	322	134	357	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.02e-22	100	354	96	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999916	0.000092

TMHMM  Annotations     

Start	End
50	72