CAZyme Information: ZTRI_3.1063.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.1063.mRNA-p1
• CAZy Family: GH3
• CAZyme Description: similar to pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		34472.63	6.7822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:3248792-3249927(+)

Full Sequence      

MLPYFFLLLAASASLVNASPAVHGAEQYRQGVVDLPLGYASLNGGMHGGQGGRVTIVSDL
TALTNAAADPNPHIIYVNGTISGAAMVRVASYTTILGIENSSQLIGIGLAIKKVNNVIVR
NLAISRVQASTGDAISIQYAKNVWIDHMDLSSDMDHDKDHYDGLLDITHGSDWVTVSNTF
FHDHYKASLIGHSDSNSAEDQGHLHVTYHNNHFSNIYSRMPSIRFGTVHIFNSYYDGGDT
AVNARMGAQVLVESSVFAGVKDPVTSENSKLKGGAVVNGCDLGGKASKAQEGNLKTVPYG
YNRLRSGEVRDAVVGVAGNTLKLG

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	77	257	1.4e-82	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.20e-62	77	257	2	186	Amb_all domain.
226384	PelB	2.69e-51	4	318	9	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.54e-39	87	257	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY23085.1|PL1	1.01e-224	1	324	1	324
SMR49220.1|PL1	2.04e-224	1	324	1	324
SMR50395.1|PL1	4.12e-224	1	324	1	324
SMQ49399.1|PL1_7	9.85e-217	1	314	1	314
USW52823.1|PL1_7	4.64e-119	9	323	9	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	5.67e-46	36	265	4	258	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
3ZSC_A	1.44e-29	34	238	4	216	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
1PCL_A	1.85e-29	38	237	10	248	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1JRG_A	3.83e-28	37	237	15	259	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]
1OOC_A	5.30e-28	37	237	15	259	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QV36|PLYA_ASPNC	6.74e-95	9	321	7	321	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	1.35e-94	16	321	18	321	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|Q4WIT0|PLYA_ASPFU	1.66e-92	7	322	7	320	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|B0XT32|PLYA_ASPFC	1.66e-92	7	322	7	320	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|Q00645|PLYB_EMENI	2.22e-91	7	321	6	326	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000301	0.999674	CS pos: 18-19. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_3.1063.mRNA-p1.