CAZyme Information: ZTRI_3.1007.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.1007.mRNA-p1
• CAZy Family: PL1
• CAZyme Description: similar to glycosyltransferase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	Ztri_chr_3|CGC12	42766.40	6.1828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:3118658-3119806(+)

Full Sequence      

MLLTQSQVSVFVSSGVIIFFTFLLFLSGYVYQQQSVRGLQDAIRPRIPQAPKSLAVQDPS
NTGTNDFAKSRFFRNERGHVTFTDFNKDVHSAGANINWKRLAHIQLVRNHHDICGAIMVL
ADLHTLRSPARRVLLFPKEWAEQKKAEKGDVSDPYLDSTRRLMRMAARRYQVELHPVDPV
PSADGSETYSLASAFELYGDFDRVLNIETPGLLLDAEPLDAILGFTESTPFAMLHDTSTN
DGVHSEDLFLLQPSKTTYAEISAGLKFKEAAGFNDTYLASLFPDPVLLASSNEKTALVRS
VKVLHDVEAGAKFNETAFTDDVAYIRFSDPKLPGPEYDVPWADKVAARPKNKGADWAWTS
LYGQYAQKRMEICGLDLESWRP

Enzyme Prediction     

No EC number prediction in ZTRI_3.1007.mRNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	2.37e-06	102	233	2	122	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ49335.1|GT0	2.61e-279	1	382	1	382
SMR50340.1|GT0	7.48e-279	1	382	1	382
SMY23031.1|GT0	2.14e-278	1	382	1	382
SMR49164.1|GT0	4.33e-278	1	382	1	382
UJO17613.1|GT0	8.06e-187	1	381	5	383

PDB Hits     

ZTRI_3.1007.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.68e-11	96	373	150	434	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000001

TMHMM  Annotations     

Start	End
9	31