CAZyme Information: ZTRI_2.888.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_2.888.mRNA-p1
• CAZy Family: GH20
• CAZyme Description: similar to similar to glycosyl hydrolase family 85 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700		77563.21	5.1686

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_2:2668654-2670828(-)

Full Sequence      

MAALDAVRSTTPRGHDAQRRYADRLKGFAYLESFDELEAWTEDDVDSLQKANTPLMRAES
LVLDRNNDQNGKSRVMLIHDYKGGYNDYESCQGAAVDKDMYSCDYLQHVESFVYFSHKLV
SIPPPTWTNTCHRNGVATLGTFLVEPGSIGVERILECNEEGIFWVARKLARVAKEYGFDG
WLINIDIGFPMWAWSLEKLEGFLRQLRSDLGPKRKVVWYDALTTLNFVWYQNTFNSLNAP
YALAAGSILTNYAWRPDLAASAKDLAEKTGLGAKNVYFGIDMWAQNAQYGRNRRITWPRE
GGGGTGTGLGLDVLKDHGLRVGIFAPGWPFEHFEEHAREVDRSVWQGDAMPMDLPCDCNP
ERPHDSVARGGVVRYARGHALGTKSVFHTDFTRAFSTGATTGRIVQAHLGSQTALPLASK
ARFRSLPFSMSNKPHASVGEVSIELSGLPTRCVVSARRGSASAESGPAVAYLHLFGLDVP
TSSSKHELTVAYRHLQKGLCVFSIVGPCSPILVDKDPDKNGVSYYTTSGLKSISDISLEV
FCYGPSLLPHKSEELFELLSITIRPEGSEQSCDICDLRLQSWSTAAIAHRRLNWSVSPAD
IEDAGLRPDVPWSATTGPCAYFVVQIDGREAGRAYALDFVLSDDMSSDWAETGVAEVQIA
AVGFDGRVLTTTQRMIPWIYDIDDDDEEWVVVEHAPEDLE

Enzyme Prediction     

EC	3.2.1.96:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	82	394	9.7e-66	0.9746031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	3.15e-103	95	395	2	290	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	8.33e-81	77	417	2	330	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	1.49e-24	30	330	35	330	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
119349	GH18_chitinase-like	7.84e-04	165	217	92	144	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR47729.1|GH85	0.0	1	700	1	700
SMR46481.1|GH85	0.0	1	700	1	700
SMQ47945.1|GH85	0.0	1	700	1	700
SMY21632.1|GH85	0.0	1	700	1	700
CAE7196105.1|GH85	5.90e-137	11	669	30	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHQ_A	4.90e-18	35	347	14	324	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHA_A	1.50e-17	105	347	83	324	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	1.51e-17	105	347	88	329	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	2.01e-13	33	326	16	306	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	2.53e-13	33	326	167	457	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C7A1|ENASE_CHICK	4.14e-43	30	356	84	394	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
sp|Q8BX80|ENASE_MOUSE	1.11e-37	30	335	78	364	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	2.09e-37	30	335	86	372	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1
sp|Q9SRL4|ENAS2_ARATH	1.28e-36	72	345	67	326	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|F4JZC2|ENAS1_ARATH	8.75e-36	25	331	32	307	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_2.888.mRNA-p1.