CAZyme Information: ZTRI_2.663.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_2.663.mRNA-p1
• CAZy Family: GH18|GH18
• CAZyme Description: similar to Chain A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216		21763.64	9.2389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_2:2082319-2083075(-)

Full Sequence      

MKASTIVALLAGLVSAAPADVDRRQIGSSTSNELTSGACRDVIFIFARGTTERGNMGSTV
GPQTCSALKSRIGSTSVACQGVGSPYAADVTGNFGTRGASTVGIAEGKRLFDLAASKCPN
SQIVAGGYSQGAALIAASVTDVSAAVKAKIAGVVLFGYTKNQQNRGVIPGGYPASQTKVY
CNIGDLVCTGSLTITAAHLTYGRDASSAAQFLQGTL

Enzyme Prediction     

EC	3.1.1.74:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	38	214	8e-43	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.26e-50	38	212	1	169	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY21399.1|CE5	2.92e-145	1	216	1	216
SMR47499.1|CE5	2.92e-145	1	216	1	216
SMR46250.1|CE5	2.92e-145	1	216	1	216
SMQ47716.1|CE5	2.92e-145	1	216	1	216
UJO20491.1|CE5	4.45e-69	6	216	8	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CUV_A	2.01e-61	20	205	9	195	Chain A, CUTINASE [Fusarium vanettenii]
4OYY_A	3.04e-61	25	213	1	189	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1CUW_A	4.03e-61	20	205	9	195	Chain A, CUTINASE [Fusarium vanettenii],1CUW_B Chain B, CUTINASE [Fusarium vanettenii]
1FFE_A	5.71e-61	20	205	9	195	Chain A, CUTINASE [Fusarium vanettenii]
1CUH_A	2.30e-60	20	209	9	199	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D9W1|CUTI3_NEOFI	1.22e-67	4	212	5	211	Probable cutinase 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_030250 PE=3 SV=1
sp|Q4W9Z4|CUTI3_ASPFU	4.94e-67	4	212	5	211	Probable cutinase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G03210 PE=3 SV=1
sp|B0YEP5|CUTI3_ASPFC	4.94e-67	4	212	5	211	Probable cutinase 3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_099910 PE=3 SV=1
sp|Q5B2C1|CUTI1_EMENI	5.01e-66	7	216	9	213	Cutinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut1 PE=2 SV=1
sp|Q2U199|CUTI3_ASPOR	4.06e-65	4	212	10	217	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999757	CS pos: 24-25. Pr: 0.8186

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_2.663.mRNA-p1.