CAZyme Information: ZTRI_2.1109.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_2.1109.mRNA-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	Ztri_chr_2|CGC8	68478.45	4.6334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_2:3348782-3350818(+)

Full Sequence      

MVVFRKLALFGVFAALPFLVQAQELTFEDPVDECPNYNKWSNEPHLSMGTEATLYSLTDM
RPETRCRTFVSPEVDAVAESVAADIADPDLRQLFRNAWPNTLDTTVKWRGYSADNSEEEL
AFIITGDIPAMWLRDSANQIQSYAPILKASGSKDSLASLYRGVINLQARYLMISPYCNAF
QAPPESNLKREHNGAYGGYTVRPDYSFETVFECKYELDSLAAFLQVSSTYFTQTGDAEFF
GKFNWYRAVETLLSVAEGMRDHTTYRENGSQDDSPYYITQGGVFINHHTGNPTAANTGLI
RSYYRPSDDPTVYQLFIPANMQFSHFLGLCTDIVEKLGEKPDLARRMKDLSNGVKAGIKE
HGIVSTKEHGDVYAFEVDGYGGVNMMDDSNSPSLLSAPLFGFLDVNDSVYQATRKRVLSV
LNPYWCHGPVISAVGGPHHGPSMAWPMASIVRIFTATDDDEIVRQLQQLVSSTDGLGLIH
ESIRSYNVSDWTRPWFAWANGLFGEAIVDLHKRKPHLLQKSFQQVPTRDNDDIGAPAGKV
EKPSAAAPVFPGDTHDDTYDLDHHEDGHMDAADHGLGLASAHHSLQPGSLEDMTWFWYLI
GFMAADSMEDLQDD

Enzyme Prediction     

No EC number prediction in ZTRI_2.1109.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	87	508	9e-147	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	87	507	1	415	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	8.41e-135	66	521	2	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR47948.1|GH125	0.0	1	614	1	614
SMQ48159.1|GH125	0.0	1	614	1	614
SMR46708.1|GH125	0.0	1	614	1	614
SMY21854.1|GH125	0.0	1	614	1	614
UJO16211.1|GH125	3.07e-249	28	608	33	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	3.15e-76	61	510	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.36e-74	61	510	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.02e-73	59	510	19	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	1.90e-68	74	509	12	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	3.28e-68	74	516	12	430	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.57e-124	30	521	23	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999781	CS pos: 22-23. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_2.1109.mRNA-p1.