CAZyme Information: ZTRI_2.1017.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_2.1017.mRNA-p1
• CAZy Family: GH16
• CAZyme Description: similar to cellulase (glycoside hydrolase family 5) protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	Ztri_chr_2|CGC13	48257.50	5.1967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_2:3005956-3007279(+)

Full Sequence      

MLRKAALFTTAFILTFVGYQSLRSESLEESQDFHFVLEDVDPSARATLARELPLRASGRH
IVDAKGARVKLASINWYGASDVDFVAGGLDVRHRDDIAITIREMGFNSVRFPYSDQMVLE
NPIIDPEFISANLDLLDGYDIPHDSDRKNNIEGPRALDVFTACVKAMTDAGLMVIVNDHI
TNAAWCDGFNLCDSSWKNDHLLGFCKIRQTTESWIENWKTIMKPFVDNPLVVGADLRNEP
RGIWGTFPWENWAAAAEKASEALLKMQPDWLMFVEGTSSANDCSGVKRRPVRLSIPGRVV
YSSHVYSWSGWGTLPSVPYKERPYPSFRADMVRKWGFLLDRDEAPVWVGEFGNPGHAGKG
DHHYWNGLMRYLSETDADWGYWALNPRKPGTFDEETYGLLQDDWTTPKDDYRMRDLQRLM
MPRS

Enzyme Prediction     

No EC number prediction in ZTRI_2.1017.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	61	389	2.4e-167	0.9873015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.52e-14	62	386	1	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	9.42e-09	74	406	50	378	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR47855.1|GH5_24	1.61e-253	104	424	1	321
SMY21762.1|GH5_24	1.61e-253	104	424	1	321
SMQ48069.1|GH5_24	1.61e-253	104	424	1	321
SMR46613.1|GH5_24	1.61e-253	104	424	1	321
UJO13321.1|GH5_24	1.05e-203	53	424	56	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	1.11e-42	57	406	9	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	3.00e-42	57	406	9	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
3W6M_A	6.60e-30	60	420	19	376	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	9.09e-30	60	420	19	376	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.70e-29	60	420	52	409	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	3.87e-41	43	406	28	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	6.84e-41	58	422	43	384	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|C0HLA0|GH5FP_CHAOB	2.35e-30	46	422	23	397	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P50400|GUND_CELFI	9.45e-25	54	406	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P19487|GUNA_XANCP	5.10e-23	57	410	30	360	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.922826	0.077200

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_2.1017.mRNA-p1.