CAZyme Information: ZTRI_13.162.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_13.162.mRNA-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700		77029.66	4.5147

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_13:493762-496200(-)

Full Sequence      

MGAWALTLFSCDYDLDLIKELSCLTGLPHLEAEAGKLASTASTAAQRQADHARLQESINP
NSIATLPLPAPVSANDIHYSVYAKLCSDPEKIRQHLDSGILHQHMTRLSQEVTNANSYWR
TDPYGPGYQLVMLGCCAMTLGAHLASAEMDMMRAHYRTVHFVRDAVTQIETALDPDEGYV
NGIPWDFCTKAMYEGSKHSEEDQLFPGAGMMNCWAPDHGRSRDEMAQFRAMALRSKDRMT
PAQLAKTMRSLDYDAYDLSDGVRAQSLEGYEHFFAADACGGCGKGESRNGGEAAVEVSSK
VLRELRDVGEDGGCRIRDNFSTMRSTLLWSLLAWPLTAVHGEPFFYAGHDLSSLKIMTDG
GAIYKDTARGNATRPAEDILGDGGMNTVRLRLWVNPVVPYDGGYYESYDLQNVKAAAKQY
HDKGFKIYLDFHFSDYWADPGKQAIPAAWPQEVGPLADTLRDYVSSTLEAFHNDGVDLAI
VSLGNELEHGMLWPTGFVNITAEPIDFTNLSVLYKAAREGVNDACAAGVPEPSVMIHLPN
GWDDELQLTWYDHLTASGVVQPSDWDLFGVSMYDFYGGNATLLNLETTLNAMALKYHKPI
LVVETDWAEECSIPVVPELMADTGISFSAQGQLDWVGAIVKIVKELPYGLGQGIFYWEPA
WLNSTSLGGPCQDLILFDADFSGSNVVAWSRSSANMFVGL

Enzyme Prediction     

No EC number prediction in ZTRI_13.162.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	347	679	8.8e-80	0.9619883040935673

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	3.81e-88	346	678	1	321	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	3.44e-60	345	665	39	348	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR64414.1|GH53	1.52e-284	323	700	1	378
SMR61911.1|GH53	2.16e-284	323	700	1	378
SMY29757.1|GH53	2.51e-283	323	700	1	378
SMQ56080.1|GH53	1.94e-280	323	700	1	378
USW53574.1|GH53	3.86e-164	342	700	24	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HJS_A	1.54e-74	346	677	4	316	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	3.31e-72	346	677	4	316	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
4BF7_A	1.22e-70	327	678	2	334	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1FHL_A	2.93e-68	346	678	4	318	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
7OSK_A	4.21e-34	336	678	40	379	Chain A, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P83692|GANA_THETO	7.94e-74	346	677	4	316	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
sp|B0XPR3|GANA_ASPFC	6.52e-72	326	678	5	340	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
sp|Q4WJ80|GANA_ASPFU	1.27e-71	326	678	5	340	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
sp|A1D3T4|GANA_NEOFI	1.27e-71	346	678	25	340	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
sp|P83691|GANA_HUMIN	1.70e-71	346	677	4	316	Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens OX=34413 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_13.162.mRNA-p1.