CAZyme Information: ZTRI_12.142.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_12.142.mRNA-p1
• CAZy Family: GH13
• CAZyme Description: similar to beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864	Ztri_chr_12|CGC1	93488.37	4.4458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_12:521895-525051(+)

Full Sequence      

MRPTAWLAVASWVTLGHGQNTTSFSADAIEAIIRKLHLLSDDLAEAGAQKIAAFATTAQK
SIDDTLKSSWENGTLSDERKLTDPEAFYSYGWSPPIYPSPQGQGSGDWSTAYDSARALVS
QMTVAEKVNLTIPAGDFDFAGCTGFSGTVPRLGFSGLCLMDGPAGLRGANTPNVSGFPPG
VSIGASFNRTLSYLQAHQLGVESRAKGVNVVFSPMVGPLGRIAKGGRNWEGYSNDAYLAG
QMVYPAIKGLQENVIATVKHFIGNEQETLRKPYFSGLLQPAGVTLYSSVSSNIDDQTMHE
LYLWPFYDAVKAGAGSVMSSYNRLNNSWASQNSKLLNGLLKTELGFQGFALTDWSGQHTG
VASANAGQDMVMPRPTYWGYGQLEAAVNNGSVDITRLDDMATRIVASMSRFANISNPGID
YHNDTDPSSELTTQVLLEAAIQGHVLVKNNGVLPFSTPKVLSLFGYDAVSGLNTSLEAGD
FYDVCLGNSQYYSDGQNLTVLELSLSLAGATSPTFSFPSIARNGTLIAGGGSGGSTPSYM
VSPYDAIVRQAASDETTLFTDFSEAPTVLEPISPCLVFINTQSVESADRTELADEFSDNL
VLRVADQCANTIVIIHNAGIRLVDEWIDHDNVTAVVYAHLPGQASGDALVSILYGDTSPS
GRLPYTVAKRESDYDTLGLLNPTLPTAEDPQYAQSNFTEGLLIDYRAFLAHNITPRYPFG
FGLTYSEFAYSDLTITQHCGVDRSALPPDASEYDSRPHPEGGLESLYDILTTVAVSVQNM
GNFTAAETAQLYLSVPGRGMVLRGFEKQMLQPGEKQKFHFDLRRRDLSVWDVEKQHWFLQ
EGEYEVMVGRNVLDEEGLKDSFEL

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	148	373	6e-55	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.00e-45	150	468	56	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.90e-43	177	864	120	764	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	4.61e-37	536	705	41	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.55e-36	177	404	88	313	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	1.89e-22	787	851	1	70	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR60857.1|GH3	0.0	1	864	1	864
SMQ55667.1|GH3	0.0	1	864	1	864
SMR63999.1|GH3	0.0	1	864	1	864
SMY29351.1|GH3	0.0	1	864	1	864
SMR54595.1|GH3	0.0	1	864	1	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	6.13e-157	93	851	4	825	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5NBS_A	2.37e-151	89	849	16	844	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5JU6_A	1.41e-149	92	851	24	841	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJI_A	2.90e-144	92	849	5	828	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	1.07e-143	92	837	6	814	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5ABF5|BGLM_ASPNC	2.55e-237	88	854	30	756	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|B0XPB8|BGLM_ASPFC	3.12e-231	88	854	34	760	Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	1.77e-230	88	854	34	760	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1
sp|Q5AWD4|BGLM_EMENI	1.77e-228	73	854	17	763	Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglM PE=3 SV=1
sp|A1D122|BGLM_NEOFI	1.29e-227	88	854	34	760	Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999676	CS pos: 18-19. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_12.142.mRNA-p1.