CAZyme Information: ZTRI_12.135.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_12.135.mRNA-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1715		191183.29	8.4562

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_12:482146-490313(-)

Full Sequence      

MPVFDVHLPVDDASTADMGRTTCYKRADLPPRLIFFFIHTSSSAPRTTLHLVGLLIHCTV
VICLQFHIQTSHQNLSHKPLTTDHSQTISSATLGRPSGLAHHPSFPTPNIKDPTLQAMAN
SRTNNPGLPGMSELTSGFLHCPSCPRYFTSLPELDLHQRQEQHFTLHANLAHRPATYGAR
RVPLDYTYDILSPGSSSGSDSDGIFTPSASRASSPYSSNGHGSSRPYRRTSQATNRRDSR
QDPLTVRQANNPSKMEKKDKEKFSRSEQGAVPIREESFHEFYGGWRLDEQSSGNGTGSGT
YAKKITLQRGSEKIMNYFAHKDWCRARIQGPEAMAQWKQEYEDLMDATDEEMPPLMDTLL
YDPNEQLCNHADSKSKACIVHGHPDWRECRRMRHAAIYKRNVAEFDRQNGLTKIISTFSE
RAYSHWFLISPLRSGHPTHTLQTLNASQLLRPRSIAARAAMLPAVPRSVGAAGVVVPASG
SSGLPGVCPAGCCSKLRWKDLLCSHPLTHHTPHTTLAWYIALLSIYPQDLIANHHNLPSG
PLGAQAKDPRAPTTSPGFNPLPRERRRSTGTIPTKRRGTHSAAQEEGKTQGVVEVSKDTM
LLPKSAGEGGGMTWKSARARLPPTRAVWTFLTRTRFLLFVGLAGIALIIWNGVRGSASDW
QRFYCFGPAKSPMQMTANEQAMWAGHQQTPVIFNHHEPIEVNSSTIQRVDLNPIVSTPKA
LANEERVLILTPLRNAAPYIEQHFDLLTQLTYPHRLIDLAFLVGDSTDDTVAVLAMELDR
IQSPQDSNSFRSAMIVEKDFGVTVGQDVEDRHGFAAQGPRRKAMGKARNYLLSTALKPEH
SWVYWRDVDIKDSPSKIIEDFVAHDRDVLVPNVWFHRYKDGVDIEGRFDYNSWQESDQGR
KLAASLDKDVVLAEGYKEYATGRKYMARMGDWRDNKDIEIPLDGIGGVNIIVKADVHRAG
INFPCYAFENQAETEGFAKMARRAGYGVYGLPNYVVWHIDTDEKPASDSLHDDAIFHCAT
PLPDLDVLERFDIRERSCWRLTYARFPILAATSMAAPPPKRGRLSLYEDKISDESRAEIK
ARDDAAVAAKEAQKKKDAALLFKPTSLGRKPINNPQKARPKPNFANIPKWASSSPSVGNI
AAPQPLTSSDGGHMSSTPQQPQGNSQKRGFDDWLANEDEEYHYYEKDWRGLPSKKNKKQK
QWPQKKKQPKNKQTYEDFGEIYDPSRPVNFVQYAKSDEALDLKEAWKRRLYNAERRERKL
RGLPPKSPLREERQTSSADRGRSVDAPPQANRMFAPPTEYESSAAYARQVPSRSPSPVRF
TNNHDNAPTYAPPMEVPREETAEEAYARRVALSGMPVAPSPPVTRIEPPPPPPEPVQKPT
PKLLSAEDEEKRAKVTEKLAQLKVQIAAQKAAREAADAAARAEQQSREPEAMVPTIRHEE
APVEFQNFTQQDLDDVQAVLKRPDEDMEDDLAARPMLGSGAPVDTPSPVSTTIVGAPTYN
PEYFAKTGAAASAPKPPQEKKPKDPLQESYDRHAFKSNKPGQVGFAERQLRKYGWEEGKG
LGAGEDGMSTAILFKNSKQGKNEGIGSAKTVKIIPGKKSVATVAAEKAAADQDRDADMSE
VVKLEGMLDGLDVDYEISENDLLQEIGDEVASYGKVERVFIWRPQLGGKDEVFVKFTSQL
SALRAVKGMGDMEFGQNRVRARFWDTEKFEAGVYE

Enzyme Prediction     

No EC number prediction in ZTRI_12.135.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	703	966	3.3e-105	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.72e-147	705	967	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
410051	RRM_UHM_SPF45	1.26e-12	1619	1711	2	92	RNA recognition motif (RRM) found in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins. This subgroup corresponds to the RRM of SPF45, also termed RNA-binding motif protein 17 (RBM17), an RNA-binding protein consisting of an unstructured N-terminal region, followed by a G-patch motif and a C-terminal U2AF (U2 auxiliary factor) homology motifs (UHM) that harbors a RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain) and an Arg-Xaa-Phe sequence motif. SPF45 regulates alternative splicing of the apoptosis regulatory gene FAS (also known as CD95). It induces exon 6 skipping in FAS pre-mRNA through the UHM domain that binds to tryptophan-containing linear peptide motifs (UHM ligand motifs, ULMs) present in the 3' splice site-recognizing factors U2AF65, SF1 and SF3b155.
409809	RRM_UHM_SPF45_PUF60	5.61e-12	1619	1705	1	85	RNA recognition motif (RRM) found in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins. This subfamily corresponds to the RRM found in UHM domain of 45 kDa-splicing factor (SPF45 or RBM17), poly(U)-binding-splicing factor PUF60 (FIR or Hfp or RoBP1 or Siah-BP1), and similar proteins. SPF45 is an RNA-binding protein consisting of an unstructured N-terminal region, followed by a G-patch motif and a C-terminal U2AF (U2 auxiliary factor) homology motifs (UHM) that harbors a RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain) and an Arg-Xaa-Phe sequence motif. SPF45 regulates alternative splicing of the apoptosis regulatory gene FAS (also known as CD95). It induces exon 6 skipping in FAS pre-mRNA through the UHM domain that binds to tryptophan-containing linear peptide motifs (UHM ligand motifs, ULMs) present in the 3' splice site-recognizing factors U2AF65, SF1 and SF3b155. PUF60 is an essential splicing factor that functions as a poly-U RNA-binding protein required to reconstitute splicing in depleted nuclear extracts. Its function is enhanced through interaction with U2 auxiliary factor U2AF65. PUF60 also controls human c-myc gene expression by binding and inhibiting the transcription factor far upstream sequence element (FUSE)-binding-protein (FBP), an activator of c-myc promoters. PUF60 contains two central RRMs and a C-terminal UHM domain.
410052	RRM3_UHM_PUF60	7.87e-11	1619	1712	1	95	RNA recognition motif 3 (RRM3) found in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins. This subgroup corresponds to the RRM3 of PUF60, also termed FUSE-binding protein-interacting repressor (FBP-interacting repressor or FIR), or Ro-binding protein 1 (RoBP1), or Siah-binding protein 1 (Siah-BP1), an essential splicing factor that functions as a poly-U RNA-binding protein required to reconstitute splicing in depleted nuclear extracts. Its function is enhanced through interaction with U2 auxiliary factor U2AF65. PUF60 also controls human c-myc gene expression by binding and inhibiting the transcription factor far upstream sequence element (FUSE)-binding-protein (FBP), an activator of c-myc promoters. PUF60 contains two central RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a C-terminal U2AF (U2 auxiliary factor) homology motifs (UHM) that harbors another RRM and binds to tryptophan-containing linear peptide motifs (UHM ligand motifs, ULMs) in several nuclear proteins. The research indicates that PUF60 binds FUSE as a dimer, and only the first two RRM domains participate in the single-stranded DNA recognition.
409679	RRM3_U2AF65	1.33e-08	1619	1702	1	89	RNA recognition motif 3 (RRM3) found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins. This subfamily corresponds to the RRM3 of U2AF65 and dU2AF50. U2AF65, also termed U2AF2, is the large subunit of U2 small nuclear ribonucleoprotein (snRNP) auxiliary factor (U2AF), which has been implicated in the recruitment of U2 snRNP to pre-mRNAs and is a highly conserved heterodimer composed of large and small subunits. U2AF65 specifically recognizes the intron polypyrimidine tract upstream of the 3' splice site and promotes binding of U2 snRNP to the pre-mRNA branchpoint. U2AF65 also plays an important role in the nuclear export of mRNA. It facilitates the formation of a messenger ribonucleoprotein export complex, containing both the NXF1 receptor and the RNA substrate. Moreover, U2AF65 interacts directly and specifically with expanded CAG RNA, and serves as an adaptor to link expanded CAG RNA to NXF1 for RNA export. U2AF65 contains an N-terminal RS domain rich in arginine and serine, followed by a proline-rich segment and three C-terminal RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). The N-terminal RS domain stabilizes the interaction of U2 snRNP with the branch point (BP) by contacting the branch region, and further promotes base pair interactions between U2 snRNA and the BP. The proline-rich segment mediates protein-protein interactions with the RRM domain of the small U2AF subunit (U2AF35 or U2AF1). The RRM1 and RRM2 are sufficient for specific RNA binding, while RRM3 is responsible for protein-protein interactions. The family also includes Splicing factor U2AF 50 kDa subunit (dU2AF50), the Drosophila ortholog of U2AF65. dU2AF50 functions as an essential pre-mRNA splicing factor in flies. It associates with intronless mRNAs and plays a significant and unexpected role in the nuclear export of a large number of intronless mRNAs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR60849.1|GT62	0.0	600	1715	1	1116
SMY29343.1|GT62	0.0	600	1715	1	1116
SMQ55658.1|GT62	5.91e-291	600	1007	1	408
SMR63991.1|GT62	5.91e-291	600	1007	1	408
UJO24213.1|GT62	1.51e-252	600	1007	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.36e-59	706	1002	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	2.03e-94	703	999	74	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	2.31e-91	692	1010	48	363	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	2.48e-74	704	1010	170	520	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	7.90e-72	700	1010	70	427	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	9.35e-61	706	998	73	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999951	0.000038

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_12.135.mRNA-p1.