CAZyme Information: ZTRI_11.519.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_11.519.mRNA-p1
• CAZy Family: GH128
• CAZyme Description: similar to fibronectin type III domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	Ztri_chr_11|CGC2	68713.33	4.8251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_11:1569020-1571310(+)

Full Sequence      

MLWRSTTQRAALICGLGLLSALSSPAAAQHEIGDNFGVSERSQDGEARRDPMRVLVVGDS
MTHCDPGDYTWRWRLLEWFEAQGIAFEYVGPYSGTLGIPDATPPIAPLPYGTSAPKEEPN
FNGSYADGIDSDGRLNHFAVIGRATKTDVPLIEQVVRDHPADLMLVDMGFNDLGWFYSDD
VELVNNTWTFIQNTRRASPNMKFVLATIVHRTFLGGRQDLVRMTDSFNRAMKSKVSEWST
PGSPVTWAPVREEYECGPQYGIKGCPAAWDGLHPNELGEYQIARGFSRALVSALGIGKAP
LEVPKDIPRRPLPPPSNFQVASSAYGVTATWNEGIHAAYEYDVERIINGGAVNDSSSEQV
KANRWDAKYSEKGWSYQVRIRSSAGNRKGDWSNWLTAIAKPESAAPPADVTVHSTPSGFD
ITWTAPSGKYSDSIIQYDIYWQDQDLQCAYPQNAGFEPTGSAHIVNLTAGHRHTVSIDAW
NAAGPGLPFLARDIVPGSGVPGTTTGLQVGVTNDTHFHLTWDAMRGAAGYYVLSRSISQS
ETRWEKVDGTFSRPCADVLAPTNGTYEYAITAFNGDTDGGRSQAVEAPKAGSPSVGACPA
PPDPCPPTDPSTIPGTDPIDPSDPPPVNSTKTDS

Enzyme Prediction     

No EC number prediction in ZTRI_11.519.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	52	290	4.2e-35	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.33e-21	131	290	11	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	4.64e-07	156	289	57	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238020	FN3	2.29e-06	406	488	3	85	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
404371	Lipase_GDSL_2	2.39e-05	136	282	37	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238881	SGNH_hydrolase_like_6	3.75e-05	136	290	21	177	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ09962.1|CE0	5.69e-110	41	604	504	1065
SCG40251.1|CE0	1.69e-92	42	586	326	863
BAE63679.1|CE0	1.22e-67	11	323	22	323
BAE60780.1|CE0	1.44e-66	101	334	16	245
CAK39824.1|CE0	2.74e-65	52	311	139	388

PDB Hits     

ZTRI_11.519.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

ZTRI_11.519.mRNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000465	0.999527	CS pos: 28-29. Pr: 0.9626

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_11.519.mRNA-p1.