CAZyme Information: ZTRI_11.458.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_11.458.mRNA-p1
• CAZy Family: GH128
• CAZyme Description: similar to glycosyl hydrolase family 88

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	Ztri_chr_11|CGC4	42992.49	6.3660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_11:1398751-1399940(+)

Full Sequence      

MPQQPIRIEGLSAGNVQVNIELLVDNLVSIKDETGQFLLRLPDGRVIDTKGWNDWEWTHG
IGLYGLWQYHTLTNSPKALQIINDWYTAQLATGTTKNINTMSVMLTLACLYEKTQDQTYL
PWLDSWAEWAMYDLPRTRFGGMQHITYLDANKQELWDDTLMMTVLPLAKIGKVLNRPQYI
EEAKFQFLLHIRYLCDPSTGLFFHGWKFDSSAAGGVGHHFAKARWARGNAWLTIAIPEFI
ELLDLAPGDALREHLLATLVSQCEALRALQDRSGCWRTLLDVSEIEGSYVEASATAGIAY
GMLKAARKRYISKEFKAVAWAAVHAVFQRIDVDGELKDVSFGTAMGHDLQHYKDIPVTSM
PYGQAMAMMMLVEVMRKFH

Enzyme Prediction     

No EC number prediction in ZTRI_11.458.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	376	6.5e-102	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.06e-98	26	377	7	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	6.79e-88	30	376	2	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ55448.1|GH105	1.16e-285	1	379	1	379
SMR60657.1|GH105	1.16e-285	1	379	1	379
SMR63772.1|GH105	1.56e-274	1	379	1	379
SMY29130.1|GH105	1.01e-270	1	379	1	379
UJO23795.1|GH105	3.88e-213	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	3.00e-172	9	378	2	372	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	3.99e-143	20	378	30	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.35e-142	3	378	16	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	2.08e-14	55	319	23	291	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.62e-40	55	376	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.48e-11	156	323	201	365	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.01e-10	171	338	10	175	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.01e-10	171	338	10	175	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_11.458.mRNA-p1.