CAZyme Information: ZTRI_11.40.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_11.40.mRNA-p1
• CAZy Family: GH12
• CAZyme Description: similar to chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	Ztri_chr_11|CGC5	25372.74	4.7393

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_11:150089-150859(-)

Full Sequence      

MRTTLTLLALAEVSTFAFGYDIPDNLRDIYSNHKSGKCNNKLAGGFDDGSLAYCGDIPHA
IYLHSQRNGGRYDNMDIDCDGANRSAGRCSNDPTGQGETAFKDTVKQYGISDLDANKHPY
VVFGNSGSNPSFNPEDEHMHPLSVMAVVCNNQVHYGVWGDTNGGTSTGEASLALANLCFP
NDSLSGDNGHGEYDVMYIGFKGTHAVPGDSANWKAGSAKEFQSSIKDLGDSLVAQLSG

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	14	234	3.3e-81	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	9.43e-98	75	235	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ55022.1|GH75	8.16e-181	1	238	1	238
SMR60234.1|GH75	3.32e-180	1	238	1	238
SMY28686.1|GH75	3.32e-180	1	238	1	238
SMR63344.1|GH75	3.32e-180	1	238	1	238
USW54018.1|GH75	5.17e-117	1	237	1	225

PDB Hits     

ZTRI_11.40.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	4.30e-113	1	237	1	241	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	2.22e-104	13	236	11	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	2.22e-104	13	236	11	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	1.84e-102	7	236	6	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	1.82e-99	8	236	1	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999758	CS pos: 19-20. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_11.40.mRNA-p1.