CAZyme Information: ZTRI_10.532.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_10.532.mRNA-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		53257.75	9.7285

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_10:1539619-1543493(-)

Full Sequence      

MPSLSTLTLLATLTSLIQGSSLLPRQGTAGVTTRYWDCCKPSCSWPNKAAFSSPVKICGK
DDNPMSDPNTVSGCDGGPGFQCSNQRSWAKTESLAYGFAAVNGGNEAGSCCACYKLKFTS
EAAMGKTLVVQVTNIGYDVGATQFDLALPGGGVGIFPQGCRNQYGVQNGWGSNGGYGGVS
SEAECMTLPAALQDGCKFRFQWFKGSNNPSVMYERVACPADLTGSRDPQTTPTQLKSSNL
PTNQPNTTQPNPQPPTTSTNMGFGDLFRSSKKHSSKPSSSSRRAHSPEPFPSQFSSLDEI
RPWLSGDRRAEFLPPSIYDTPTPSRSHSSRRPARPITPPRREYTSSRSPFQSTRSRPVSP
LGYSDYSRSSSRRPRSPVSPLSAPRESSRRREGSRREPAPRYGGSSSYDLPDFSRSPRRE
YDDLDYLGSGRRQQPSSYGRSVQPERRPSHSSSRRGASPGGSEYGGVDLSSLGGGYNPYG
GYQTREYRPGGY

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	30	224	1.1e-73	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	3.17e-60	29	222	1	207	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY28618.1|GH45	0.0	1	492	1	492
SMQ54963.1|GH45	0.0	1	492	1	492
SMR59404.1|GH45	4.26e-162	1	222	1	222
SMR63238.1|GH45	1.41e-160	1	222	1	222
ALL62703.1|GH45	2.20e-77	26	223	20	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GLY_A	1.56e-66	29	222	4	194	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	1.78e-66	29	222	7	197	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
6MVI_A	3.45e-66	29	223	25	216	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5H4U_A	1.19e-64	29	223	21	214	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
1L8F_A	3.08e-60	30	226	3	199	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D3GDK4|GUN_CRYAT	5.08e-64	29	223	21	214	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P45699|GUNK_FUSOX	1.12e-62	29	222	21	213	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	3.15e-57	30	226	3	200	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|O97401|GUN_PHACE	4.37e-50	30	222	40	234	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	5.06e-40	27	223	266	493	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000288	0.999679	CS pos: 19-20. Pr: 0.9738

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_10.532.mRNA-p1.