CAZyme Information: ZTRI_10.518.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_10.518.mRNA-p1
• CAZy Family: GH10
• CAZyme Description: similar to glycoside hydrolase family 37 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		70534.47	4.1920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_10:1506956-1508869(+)

Full Sequence      

MKNYLLLAAGLPLIAATWTNGSVIAPCESTLYCQGEILRAIQLAGAFVDSKTYVDLPTIR
PLEDVVAAFEQLTQPLSNNTELQNFLSENFGEAGSEVENVDPDSLTTDPTFLEHVDDEDL
RDFLEQVIDVWPELTRKYVGASDCTGCVSSFIPLNRTFVVAGGRFREPYYWDSYWILLGL
LRTKGSFTEIALNIIENFLDLVDEFGFVPNGARQYYLNRSQPPVLTLMVKAYVEYTNDTS
ILERMLPTLEREYSFWTTNRSVDVDVNGTTYILNRYNVNNNQPRPESYIEDYRTATNSSF
YAPSGIIYPSNPLNDTQIAQLYSDLASGAESGWDYSASRWTRNPTDAITDTYFPLRSLNT
ANIIPVDLNSILYANEAILAQFHNLTGNATAAEQWSALAETRSKAMTAVLWDPDQWGYFD
YNITSSSRQIYVPADSSATSDHTHSPSSPPGLQVTVHAAQFYPFWTGAAPIWLKNNPSAV
LRAFRRVENQLDTFPGAPPATNLATGQQWDEPNVWPPLTYILVQSLLNVSPTFGTEDPSY
NKTQTLALEIAQRYVDSAFCTWRSTGGRTRKLPPLGGEEGGEGAIFEKYNSTSVLVGGGG
GEYEVQTGFGWTNGVLIYFGDVFGGRLGVGGCTAEGG

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	47	619	8.2e-157	0.9877800407331976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.26e-147	47	624	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	3.74e-145	31	625	12	546	alpha,alpha-trehalase
224541	TreA	8.30e-95	35	624	59	553	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	7.88e-84	36	625	51	538	alpha,alpha-trehalase TreA.
237326	treA	2.38e-81	35	615	49	528	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY28604.1|GH37	0.0	1	634	1	634
SMR63222.1|GH37	0.0	1	635	1	635
SMR59387.1|GH37	0.0	1	637	1	637
SMQ54948.1|GH37	0.0	1	634	1	634
UJO12022.1|GH37	0.0	1	635	1	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	1.57e-76	49	624	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.27e-75	49	624	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	2.65e-74	35	617	15	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	1.44e-72	35	617	52	533	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	2.09e-71	35	617	15	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	5.00e-126	27	618	49	580	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	1.57e-112	2	627	12	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P32359|TREA_TENMO	8.55e-105	27	619	25	548	Trehalase OS=Tenebrio molitor OX=7067 PE=2 SV=1
sp|Q9JLT2|TREA_MOUSE	2.17e-104	26	627	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	2.87e-103	26	627	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000333	0.999628	CS pos: 16-17. Pr: 0.8965

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_10.518.mRNA-p1.