CAZyme Information: ZTRI_10.270.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_10.270.mRNA-p1
• CAZy Family: CE4
• CAZyme Description: similar to glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42956.82	6.9666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_10:748555-749700(-)

Full Sequence      

MGRPTINGNLQMWHPSSSTPALRKIWTLVLFLLCCFIFYVGRTHLSGPRRPWFDHADIIP
HKMWQSWKVDALSFEDRDSERARAWTAKNPDWRYEVLTDGNAVAYVEQHFGPKGFGRPDI
VKIFKALDGRLKIIQADLLRYLIMYVEGGLWADIDAEALSPISRFIPSRFEESSVDMIIG
IETDEPDFLTHPILGSKAQSFCQWTFLTKPGHPAMLTLVEDILQWLKRLSTESGKAIADL
DLDFDQVLSGTGPSAFTHAILAHMSATIGREVTWSENFHDMSDSTLVGGTLVLPAEAFAA
GTGHSRSGTHSGSRALVKHHFHASGWTSKHPRRKHPVYGEVERCNWNKACVELWDENVGA
FSKLSQQQQSEMIRTTQARDA

Enzyme Prediction     

No EC number prediction in ZTRI_10.270.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	167	1e-15	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.89e-14	59	258	82	281	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.87e-07	85	167	11	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.008	52	228	54	195	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ54686.1|GT32	4.76e-281	12	381	1	370
SMR62964.1|GT32	2.73e-238	63	381	1	319
SMY28334.1|GT32	1.58e-237	63	381	1	319
SMR59126.1|GT32	7.49e-236	63	381	1	319
UJO17754.1|GT32	3.76e-178	27	373	27	371

PDB Hits     

ZTRI_10.270.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.62e-31	55	326	139	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.96e-25	53	324	93	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.21e-24	53	298	124	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	5.31e-20	53	222	90	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000004

TMHMM  Annotations     

Start	End
21	43