CAZyme Information: ZTRI_1.920.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.920.mRNA-p1
• CAZy Family: CE1
• CAZyme Description: similar to SUN domain protein (Uth1)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		43804.14	4.6830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:2659997-2661331(-)

Full Sequence      

MHLSFALLSAAIICANAQPHAHAHGHAHLHKHKRDPVPDQVVVPGPVEVVYVLNGIAISE
ADVQQGIKNGSLIFADNGELADAPPSYVVPTSTPVAASSAPPTSVAPTSSAAPSSSPVPV
SSAAEASSTPSEPSPPTYSGGDGVDRDFPDGELDCSTFPSDYGAIPVPWTGLKGWTGIQT
CSGGSDSGGYEHISTKTSGQSPEEGDYCSYACPAGYQKSQWPSTQGSTGQSIGGIKCSGG
KLHLTNPGLSKRLCIRGAEAVTILVQNKLSKNVAVCRTDYPGTESETVPVNVEAGSTNNL
TCPDADNYYKWQGGSTSAQYYVNPAGVAVEDACQWGTAGTPTGNFAPMNIGVGWNNGAAW
LSVFQNSPTTDAKQKFTVEIVGDGVSGTCKYQNGQYCGGANYDSCSSTTGCTVSLSSGTA
TFVFSD

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	113	424	6.9e-96	0.966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	6.82e-127	150	412	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR44353.1|GH132	2.68e-276	1	426	1	426
SMR42173.1|GH132	2.68e-276	1	426	1	426
SMQ45830.1|GH132	2.68e-276	1	426	1	426
SMY19508.1|GH132	2.68e-276	1	426	1	426
AQA29332.1|GH132	1.57e-179	3	426	4	434

PDB Hits     

ZTRI_1.920.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	4.61e-110	51	424	45	413	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	9.08e-99	38	425	41	447	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|A7A003|UTH1_YEAS7	2.02e-70	147	424	105	361	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2
sp|B3LRC2|UTH1_YEAS1	2.02e-70	147	424	105	361	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|B5VMJ0|UTH1_YEAS6	2.02e-70	147	424	105	361	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999752	CS pos: 17-18. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_1.920.mRNA-p1.