CAZyme Information: ZTRI_1.1828.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1828.mRNA-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738	Ztri_chr_1|CGC12	80487.34	4.5156

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:5166854-5170042(+)

Full Sequence      

MEPPYTHIVVGAGSAGCVVAARIAENPSLNVLLLEAGPEPEISTGSQNIRRVPMKGQSET
FDDRIDWNIEVGFPDGGSMHVAQAKVVGGGSSINGGTALRNAVKDCEEWVLLGNDAWGWD
SVEPVYDFLEKDDLRPTKGFHPLVRTKIEGSGLIQQAFVAGAIEAGLPWVADLNATGAEG
TGASPVCRNGERRISAANTFIDPIRGRRNFRIQSNAFVDRVLFSDRRATGVKLVDGSQIS
ASCEVILAASALFSPAILQRSGVGPSALLESLAIPVLQDLPVGHNLSDHPCIPVVARPKP
DAYLESDFSLQMQARWSSTMNQKAIDLQMVCFSYLFVAPGAPQPGASSRPQRSLGGSETG
HVAGIGCNLNKPTSHGSVQIGSKDPLQQPVVRPNYLTTAEDRTSAREIVRLGYKIMLSRS
MQSRLSLPLGITDDTIRSDNLLDKWIQSQYSSTYHFCCSCRMAAHTVVQREERCENLLQI
EKEAENVYRSGVGSDESVKDGLEEVRENLDIPERAQAKSRPDGIVEDIAAEDEDEDNDNE
LVEGMESGDEGEEEGDDEEEDNVADLAETISKQEDLNWHTDSKQSTLLFVACIFHDLGTS
STYDTGPTRFEIEGADAAVNFLKQYPTITEAERHEVWTAIAIHDTPQIAERISVLPRLVR
LGVTIDFKRPAALAMVSEKWVKHVETEFPRVEIEKVLGDAVVEQALKVPEKAPAACWPGL
LLRAKLADPEWEGVNKAF

Enzyme Prediction     

No EC number prediction in ZTRI_1.1828.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	468	1.1e-89	0.9137323943661971

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.02e-75	1	462	2	480	choline dehydrogenase; Validated
225186	BetA	6.27e-74	1	462	4	481	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.53e-65	8	464	4	435	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	5.05e-37	75	291	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.75e-17	5	290	56	328	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY20441.1|AA3	0.0	1	570	1	570
SMQ46758.1|AA3	0.0	1	464	1	464
SMR43118.1|AA3	0.0	1	464	1	464
SMR45279.1|AA3	0.0	1	464	1	464
CAB3230510.1|AA3_2	8.82e-43	5	464	25	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F97_A	2.54e-35	5	455	6	467	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4HA6_A	3.45e-35	8	462	5	453	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
3T37_A	4.33e-35	8	462	21	469	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
4UDP_A	1.12e-34	5	455	6	467	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
4UDR_A	1.21e-33	5	454	6	466	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q88CW6|BETA_PSEPK	6.46e-48	1	477	1	499	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=betA PE=3 SV=1
sp|Q47944|SDH_GLUOY	6.76e-48	1	462	1	476	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q1IG70|BETA_PSEE4	7.81e-47	1	477	1	499	Oxygen-dependent choline dehydrogenase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=betA PE=3 SV=1
sp|A5WA97|BETA_PSEP1	1.07e-46	1	477	1	499	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.25e-46	5	462	43	520	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_1.1828.mRNA-p1.