CAZyme Information: ZTRI_1.1792.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1792.mRNA-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	Ztri_chr_1|CGC8	105150.67	4.5552

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:5077954-5083290(+)

Full Sequence      

MVSTRWLLATLACRLLTTTAQSEATQRLADVLFAIGLVPDEALATAAAGLLVSGANATSE
GLQQALSAPGIDEQKRTQAELFYSYGGSPPVYPSPKGSGAGDWAEAYGKAQALVAQMTNE
EKNNVTTPVLSTRGCSGFTGTVERLGFPGICLNDGPAGVKGPVAENETRANGFPAQLSVG
ATWNRGLAYWRGQQMGKEFKAKGVDVALAPVLGPLGRIATGGRNWEGFSNDPFLAGALVE
LTIKGLQESVVACAKHFIGNEQETQRNPFLVGYLDDGNYTLNASVSANIDDSTMHELYLW
PWYDAVRAGVGSVMCSYQRINNSYACQNSAALNGLLKGELGFQGFVVSDWFAQHAGIATA
ETMEMAMPDPRYWGNGTLSTAVSNGSLKADRLDDMATRILASWYRYSTTELVGLENHYDQ
DVRQPESAAAAFQVAVEGHVLVKNVNNALPLSKPTVLSVFGWDAVAGSTADPTQSLGGVG
LANSQIFTTGQNFSALTYLQLVAATAPIGTTIPDVALNGTLIAGGGSGSCLPATVSGPYE
ALLRQALSDGTKVYNDTRVTDSPVVEDGSGVCLVLINAQAAEAADRTTLADEFSDNYVDA
VASQCANTVVIIHNAGIRLVDRFFDHENITAILYGHTPGPASGDALVELLYGRQSPSGRL
PYTVAHDEADYGSLLRPDLPTEQDPQYAQSNFTEGVFIDYRRFMKEGISPRFEFGYGLTY
TNFSYSNFSVSKVPNARFDLAPPGSKSSALAPEGGLASLYDVLATACVTVTNTGEVAAAE
VAQLYVNIPGSGVERALRGFEKKLLQPGESAEYTFDLKRRDLSLWSMEKQDWMLQDGQYE
IVMGKSVLDVQGTAVFSVYPLRPKGRQMKEWRKENPLPKQQKSGGEAATKATEGGEEGDE
EDPMDTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLSFAGKQLEDGRTLSDYNIQK
ESTLHLVLRLRDSASAVVCRSS

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	141	355	1.2e-56	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340501	Ubl_ubiquitin	2.71e-43	906	971	9	74	ubiquitin-like (Ubl) domain found in ubiquitin. Ubiquitin is a protein modifier in eukaryotes that is involved in various cellular processes, including transcriptional regulation, cell cycle control, and DNA repair. Ubiquitination is comprised of a cascade of E1, E2 and E3 enzymes that results in a covalent bond between the C-terminus of ubiquitin and the epsilon-amino group of a substrate lysine. Ubiquitin-like (Ubl) proteins have similar ubiquitin beta-grasp fold and attach to other proteins in a Ubl manner but with biochemically distinct roles. Ubiquitin (Ub)and Ubl proteins conjugate and deconjugate via ligases and peptidases to covalently modify target polypeptides. Ub includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains.
224389	BglX	1.93e-42	144	453	57	352	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.84e-42	173	851	120	758	beta-glucosidase BglX.
395747	Glyco_hydro_3	6.96e-35	173	400	88	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.94e-32	440	700	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY20407.1|GH3	0.0	1	858	1	858
SMR45244.1|GH3	0.0	1	858	1	858
SMR43078.1|GH3	0.0	1	858	1	858
UJO21588.1|GH3	0.0	20	858	30	862
SMR53043.1|GH3	6.62e-318	31	852	34	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	1.50e-156	88	846	4	825	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5JU6_A	3.39e-153	88	860	25	855	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6JXG_A	5.80e-153	99	851	2	705	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]
6JBS_A	7.87e-151	92	850	49	795	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]
6KJ0_A	2.18e-150	92	850	49	795	Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes],6KJ0_B Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5ABF5|BGLM_ASPNC	5.72e-245	83	858	30	765	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|Q5AWD4|BGLM_EMENI	1.22e-237	61	856	9	772	Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglM PE=3 SV=1
sp|A1D122|BGLM_NEOFI	5.61e-235	83	858	34	769	Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglM PE=3 SV=1
sp|Q0C7L4|BGLM_ASPTN	3.46e-234	83	858	31	782	Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	3.58e-233	66	858	21	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000884	0.999090	CS pos: 22-23. Pr: 0.7083

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_1.1792.mRNA-p1.