CAZyme Information: ZTRI_1.1739.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1739.mRNA-p1
• CAZy Family: GT90
• CAZyme Description: similar to glycoside hydrolase family 39 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	Ztri_chr_1|CGC24	51473.70	4.6222

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:4903303-4904988(+)

Full Sequence      

MPFLSSSIALAALIAFASAESNLGGQGYVDLSVYGGTPDAKGAGILYGIPNDPAYYPGTA
PARSTWGPYFQGAGISWVRAGGAQIPFKGYASDLLEGGTEGYDKRFASFKQNFQDARALN
PNNQFVLLVHDLWGADGGQGSNTPFPCDDGDCAQYGVYLDKLIADLKDNDLLGGLHIDIW
NEPDISGFWARSQDQYLQAYDYAYSKYRAAFGTAVALVAPSTSSQPDANNDWWKNFTSHI
SANGNIPDWWSAHQLNGASSANCGNDPVNTQAGLNDVLSQHGLPARPFQLNEYAYIDEQS
PAYTAWFISRFERTGITGLRADWGSKVGLHNDLAKLLGPGGNDTTDNFYKLGDWHVLNYY
TQQQHGVITKAGATVSTCYDLYVTQERDVGSTHILAGSRGQSGAYPITVSNVDSMPAYHG
KTSLRAVINEIPYNNGGRVDCPVLYSNTTVAVSDNKIVINLEQTTNSSYTIDLYAA

Enzyme Prediction     

No EC number prediction in ZTRI_1.1739.mRNA-p1.

CDD Domains     

ZTRI_1.1739.mRNA-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR45193.1|GH39	0.0	1	476	1	476
SMQ46669.1|GH39	0.0	1	476	26	501
SMR43025.1|GH39	0.0	1	476	1	476
SMY20358.1|GH39	0.0	1	476	1	476
QYT01987.1|GH39	1.82e-74	36	415	30	391

PDB Hits     

ZTRI_1.1739.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

ZTRI_1.1739.mRNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999736	CS pos: 19-20. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_1.1739.mRNA-p1.