CAZyme Information: ZTRI_1.1681.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1681.mRNA-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1302	Ztri_chr_1|CGC11	146603.11	7.2448

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:4758592-4763761(+)

Full Sequence      

MKLSDTDQKVISQLNANWIWTPHWIDSAETNTAGRIVHFKRQVQISSLPETAVLHFSADT
RYKLYVNGARVAVGPCRSSPYIWYYDTLDIAPFLIEGQNVLEFAVIRYFASSRAAMPFER
TSYPGLTICGGFVVNDLLHDLDSTKGWRCWIDDSIRFPTGLVDDGFLHISERITSAPQAP
TYAPIPYGYKTLNGDILPWRLRPRSIPMPKESVANVHAVRSCQSARQISDWTAFLRGSAS
LTLPAKSSHRLEIQAEVHSTAFLRWTFDARQQSQIKMKVTYSEGYELEPRSYPFFRTKKD
RVDASNGHLLGPFDEIILDIVPGQMNVYEPFWFRTFRLFRLEIDVGAEAVELSKFEAKQT
NYPLDVKASWQDHGDPQSEKIWEVSIRTMRNCMHDAYSDCPFYEQLQYSGDSRSVGLFHY
LISGDDRLMRQTINNFASSIGSEGLTQSRFPSHVMQLIAGFSIYWILQVCDHHLFFGDTA
HSRSFLPRIDGVLEFFASYVDERGLVSGLPADVWQYVDWVTTWGATDDHPDKGVPTSGRK
SNLHTYFSLLYAYGLQKAAKLLIEVGRPAHAAEYESRAQSLQRAVRTHCYDGSFFTDSTS
DVAGDDAYSQHCQVFAVLSGAAEGTERFRLLHEAFNKPMFSKCSYVMRFYALRAFSIAGD
ELYESMWQPTWEPWRQMLANNLTTWEEDDVRQRSDCHAWGSVPIYEYCTELAGVQPLGPG
CKKVLFKPRLNLSKAIDAVVALGKDNLAKVSWSIDANGEKQRLSSASATQTEDEMTNERP
FEKTVDTHIEEHVHSGPTMQMRSKTDDDSVWQSMKKYKRVGVVAMSAAFAASLDGYQITL
NGGIVSNKGFIRQFATPGTKIIAGKYISAWGGIQSAGQALGQIGLQFVADAFGRKVALLT
LWVFLVASIFAETFATRWEHWLVAKLFSGMGVGMLQSTVPVYLSEVAPTQLRGFFINAYT
FWFVVGQLFGSVALKSLRDSDPYDFRTAIYTQWAMVGTMGTIFFLLPETPWWLVQKGRSS
DAAKILRKYNGHIDGYRVQESIDIMNNTIEEERHLAKRDSQEGFFSVFQGQNLIRFVIAA
WPKITQQLVGLTVFNTYATYFFQYAGNKDPFLVTVILSCCQILSMMVTCSLTDTIGRRPL
TIYPYGVTVLSVLSIGIIGCFDYKAQATGSLLVFFGCMATFATTGASAIGYAYAAEVPQQ
RLRARTAAFGLAASNCIAIMFNFCTPLMINGTNKWGVKTGFFFAGTGALAVAISWYILPE
LARRTPAEIDEMFEKKVTLRKFKRYVTDVQMNVEEPSKLEGT

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	261	763	8.2e-87	0.9345238095238095
CBM67	16	150	3.4e-22	0.7215909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395036	Sugar_tr	1.76e-56	823	1273	1	452	Sugar (and other) transporter.
340914	MFS_HXT	6.95e-39	827	1273	6	403	Fungal Hexose transporter subfamily of the Major Facilitator Superfamily of transporters and similar proteins. The fungal hexose transporter (HXT) subfamily is comprised of functionally redundant proteins that function mainly in the transport of glucose, as well as other sugars such as galactose and fructose. Saccharomyces cerevisiae has 20 genes that encode proteins in this family (HXT1 to HXT17, GAL2, SNF3, and RGT2). Seven of these (HXT1-7) encode functional glucose transporters. Gal2p is a galactose transporter, while Rgt2p and Snf3p act as cell surface glucose receptors that initiate signal transduction in response to glucose, functioning in an induction pathway responsible for glucose uptake. Rgt2p is activated by high levels of glucose and stimulates expression of low affinity glucose transporters such as Hxt1p and Hxt3p, while Snf3p generates a glucose signal in response to low levels of glucose, stimulating the expression of high affinity glucose transporters such as Hxt2p and Hxt4p. Schizosaccharomyces pombe contains eight GHT genes (GHT1-8) belonging to this family. Ght1, Ght2, and Ght5 are high-affinity glucose transporters; Ght3 is a high-affinity gluconate transporter; and Ght6 high-affinity fructose transporter. The substrate specificities for Ght4, Ght7, and Ght8 remain undetermined. The HXT subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340916	MFS_GLUT6_8_Class3_like	2.06e-37	867	1268	43	436	Glucose transporter (GLUT) types 6 and 8, Class 3 GLUTs, and similar transporters of the Major Facilitator Superfamily. This subfamily is composed of glucose transporter type 6 (GLUT6), GLUT8, plant early dehydration-induced gene ERD6-like proteins, and similar insect proteins including facilitated trehalose transporter Tret1-1. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). Insect Tret1-1 is a low-capacity facilitative transporter for trehalose that mediates the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340915	MFS_GLUT_Class1_2_like	5.22e-34	827	1264	4	447	Class 1 and Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily. This subfamily includes Class 1 and Class 2 glucose transporters (GLUTs) including Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1, also called glucose transporter type 1 or GLUT1), SLC2A2-5 (GLUT2-5), SLC2A7 (GLUT7), SLC2A9 (GLUT9), SLC2A11 (GLUT11), SLC2A14 (GLUT14), and similar proteins. GLUTs are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUTs 1-5 are the most thoroughly studied and are well-established as glucose and/or fructose transporters in various tissues and cell types. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340917	MFS_XylE_like	1.26e-26	877	1260	48	383	D-xylose-proton symporter and similar transporters of the Major Facilitator Superfamily. This subfamily includes bacterial transporters such as D-xylose-proton symporter (XylE or XylT), arabinose-proton symporter (AraE), galactose-proton symporter (GalP), major myo-inositol transporter IolT, glucose transport protein, putative metabolite transport proteins YfiG, YncC, and YwtG, and similar proteins. The symporters XylE, AraE, and GalP facilitate the uptake of D-xylose, arabinose, and galactose, respectively, across the boundary membrane with the concomitant transport of protons into the cell. IolT is involved in polyol metabolism and myo-inositol degradation into acetyl-CoA. The XylE-like subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR45134.1|GH78	0.0	1	1302	1	1302
SMQ46612.1|GH78	0.0	1	1302	1	1302
SMR42963.1|GH78	0.0	1	1302	1	1302
SMY20297.1|GH78	0.0	1	1302	1	1302
BCS19487.1|GH78	0.0	1	760	2	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	9.05e-32	334	759	503	924	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6N3I_A	8.82e-17	920	1274	155	506	Crystal structure of a double Trp XylE mutants (G58W/L315W) [Escherichia coli]
4QIQ_A	9.63e-17	920	1274	127	478	Crystal structure of D-xylose-proton symporter [Escherichia coli K-12]
4JA3_A	9.95e-17	920	1274	128	479	Partially occluded inward open conformation of the xylose transporter XylE from E. coli [Escherichia coli K-12],4JA3_B Partially occluded inward open conformation of the xylose transporter XylE from E. coli [Escherichia coli K-12],4JA4_A Inward open conformation of the xylose transporter XylE from E. coli [Escherichia coli K-12],4JA4_B Inward open conformation of the xylose transporter XylE from E. coli [Escherichia coli K-12],4JA4_C Inward open conformation of the xylose transporter XylE from E. coli [Escherichia coli K-12]
4GBY_A	1.03e-16	920	1274	128	479	The structure of the MFS (major facilitator superfamily) proton:xylose symporter XylE bound to D-xylose [Escherichia coli K-12],4GBZ_A The structure of the MFS (major facilitator superfamily) proton:xylose symporter XylE bound to D-glucose [Escherichia coli K-12],4GC0_A The structure of the MFS (major facilitator superfamily) proton:xylose symporter XylE bound to 6-bromo-6-deoxy-D-glucose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|N1PA11|MAL11_YEASC	7.49e-39	812	1288	98	582	General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=MAL11 PE=3 SV=1
sp|P53048|MAL11_YEAST	7.49e-39	812	1288	98	582	General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAL11 PE=1 SV=1
sp|K0E3U9|ECDD_ASPRU	5.76e-36	828	1273	26	488	Major facilitator-type transporter ecdD OS=Aspergillus rugulosus OX=41736 GN=ecdD PE=3 SV=1
sp|K0DZ95|ECDC_ASPRU	7.57e-34	833	1293	63	539	Major facilitator-type transporter ecdC OS=Aspergillus rugulosus OX=41736 GN=ecdC PE=3 SV=1
sp|Q4WLW9|FMQE_ASPFU	3.33e-33	809	1283	37	522	MFS transporter fmqE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fmqE PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000002

TMHMM  Annotations     

Start	End
896	914
921	943
953	972
993	1015
1110	1132
1139	1161
1172	1194
1207	1229
1239	1258