CAZyme Information: ZTRI_1.1329.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1329.mRNA-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	Ztri_chr_1|CGC14	28796.71	7.6178

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:3805887-3806799(-)

Full Sequence      

MQHFAVALLALAIGVKALPSPPPSGSLPPFPSVSGVEPPINPPGPGIVPTGILQPFPSGP
VFSNATGIIKARNASSETAPSATTGSPKTAVAGGGLPASSGTSVLSAVKTIAAGESFDGG
MMMYDRGVSCTGQTEGGGKDAVFVLEKGASISNVIIGPRQIEGIHCNGGCSLSNVWWSAV
CEDAFTIKKQSASETTKIAGGGAYGATDKVLQHNAAGTLSVSGFTADDFGKLYRSCGNCD
DMYERHVILNDIKSSNGKILVGINSNYGDTATLVRSLLPLRMR

Enzyme Prediction     

No EC number prediction in ZTRI_1.1329.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	100	275	5.3e-76	0.9123711340206185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.26e-108	93	276	1	181	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR42602.1|PL3_2	3.60e-171	1	246	1	246
SMY19941.1|PL3_2	3.60e-171	1	246	1	246
SMR44777.1|PL3_2	3.60e-171	1	246	1	246
SMQ46255.1|PL3_2	5.63e-162	1	238	1	238
QBB21149.1|PL3_2	5.54e-101	93	272	99	278

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	7.58e-29	111	275	11	182	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	6.88e-23	101	254	6	158	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	7.04e-23	101	254	7	159	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	6.21e-22	101	254	15	167	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	6.21e-22	101	254	15	167	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ATC7|PLYH_EMENI	8.41e-70	96	273	40	214	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|Q5BA88|PLYD_EMENI	1.08e-68	96	273	42	218	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q0CJ49|PLYD_ASPTN	2.82e-66	96	273	34	208	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|A1C4B8|PLYE_ASPCL	4.67e-65	96	273	36	210	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	1.32e-64	96	273	36	210	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999779	CS pos: 17-18. Pr: 0.9836

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_1.1329.mRNA-p1.