CAZyme Information: ZTRI_1.1282.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1282.mRNA-p1
• CAZy Family: AA11
• CAZyme Description: similar to alpha-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	Ztri_chr_1|CGC17	37382.70	9.8279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:3662172-3663164(+)

Full Sequence      

MANLQFPYPRKSSVPTVSTSPRRSTYLRQRRAIRTYGPPLIGLTAIIWLLFYLFSTRPTT
ASTTLAIPPRPSNPPEVIIVTPLDPSLPQSFTSTIRANRNHYARLHNYATLFPSTHAYDL
LPNTPYSWSLVPSLRHAQTLHPHTPWIWHLSSTALIMNTTLSLDSRLLSPSVLPSLLLPD
TPVVPPDSVIHTPSHRNPASTSIILSRDATGLAHDSFLIRNSEWAKFFLDAWFDPLYRSY
NFQKAERHALEHIVQWHGTILGKVGLVQQRVLNGYVKQEEKGGEEAMYREGDFVANFWGC
GKEEGRASCEKEMGPMMEKWRGMRDAEGRS

Enzyme Prediction     

No EC number prediction in ZTRI_1.1282.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	75	305	1.1e-61	0.975609756097561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	9.26e-64	75	301	3	233	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	1.12e-06	98	232	156	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR42554.1|GT34	4.31e-229	1	330	1	330
SMQ46204.1|GT34	4.31e-229	1	330	1	330
SMY19892.1|GT34	2.49e-228	1	330	1	330
SMR44727.1|GT34	1.01e-227	1	330	1	330
UJO11889.1|GT34	2.27e-110	1	327	1	322

PDB Hits     

ZTRI_1.1282.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	9.42e-29	91	311	88	301	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	5.15e-22	69	300	97	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|P46985|MNN11_YEAST	1.31e-18	70	319	153	418	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|Q10359|GMH3_SCHPO	3.93e-18	88	300	105	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|Q09174|GMA12_SCHPO	7.90e-16	69	300	97	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000028

TMHMM  Annotations     

Start	End
32	54