CAZyme Information: ZTRI_1.1277.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1277.mRNA-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490		54340.84	6.7716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:3646626-3649374(+)

Full Sequence      

MTQPLSSTYEMASNYFPPMQYLSGNAPSDYISSLDSICPVISMSSTTNNNPNLRFYRTDS
YDGTAERRSSDSEDSLGGNNNDFADTSVHFPSTISTFSTSPSHHGLSISPPPKSPLRPPS
RPYRRVPHAAVERRYRDNLNTSISTLRLTLPSLKDACNTTVGPSDHEDAALASRGPSKAV
IISTATAYIKELQREQRKAESQIEQLKEQMADLQNLLQCNHRSVLQLLQRAAGDSHLQCN
NVARAAIRLDFHDAGPWSSELAAQGQDFGGADGSIVLSGSEIGRKEDRGLERMPAQMKQW
QRTFNVSMADLIQFGAIHAVVTCPLGSRIRFFAGRKDSRVPAVEGLLPSVTAPADELISL
FRAKTIEPHELAALLGAHSTSIQRFVDPALAGRPQDSTPMIWDVKYYNETIQERPRRIFR
LQTDVALAANPSMKDEWMDFIDPVDGQDHWNSDYATAYTRLSLLGVNNINQMTECSQVLP
AETRRRPRFA

Enzyme Prediction     

No EC number prediction in ZTRI_1.1277.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	224	466	1.2e-49	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	8.03e-98	238	484	33	292	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
381401	bHLHzip_SREBP_like	3.48e-23	122	210	1	87	basic Helix-Loop-Helix-zipper (bHLHzip) domain found in sterol regulatory element-binding protein (SREBP) family and similar proteins. The SREBP family includes SREBP1 and SREBP2, which are bHLHzip transcriptional activator of genes encoding proteins essential for cholesterol biosynthesis/uptake and fatty acid biosynthesis. SREBP1 and SREBP2 are principally found in the liver and in adipocytes and made up of an N-terminal transcription factor portion (composed of an activation domain, a bHLHzip domain, and a nuclear localization signal), a hydrophobic region containing two membrane spanning regions, and a C-terminal regulatory segment. They recognize a symmetric sterol regulatory element (TCACNCCAC) instead of E-box. The family also includes Saccharomyces cerevisiae transcription factor HMS1 (also termed high-copy MEP suppressor protein 1) and serine-rich protein TYE7. HMS1 is a putative bHLHzip transcription factor involved in exit from mitosis and pseudohyphal differentiation. TYE7, also termed basic-helix-loop-helix protein SGC1, is a putative bHLHzip transcription activator required for Ty1-mediated glycolytic gene expression. TYE7 N-terminal is extremely rich in serine residues. It binds DNA on E-box motifs, 5'-CANNTG-3'. TYE7 is not essential for growth.
173823	plant_peroxidase_like	4.53e-23	234	462	9	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	1.78e-19	245	379	18	150	Peroxidase.
173825	ascorbate_peroxidase	1.13e-14	240	467	27	251	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ46199.1|AA2	0.0	1	477	1	531
SMR42549.1|AA2	1.11e-186	231	490	4	263
SMR44722.1|AA2	1.11e-186	231	490	4	263
UJO24282.1|AA2	3.96e-94	238	490	27	266
CCF45286.1|AA2	1.38e-83	219	483	105	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FNB_A	1.67e-28	238	480	33	283	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii],5FNB_B Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii]
2VKA_A	3.32e-28	238	480	33	283	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]
1LGA_A	5.32e-28	238	480	33	290	Chain A, Lignin Peroxidase [Phanerodontia chrysosporium],1LGA_B Chain B, Lignin Peroxidase [Phanerodontia chrysosporium],1LLP_A Chain A, LIGNIN PEROXIDASE [Phanerodontia chrysosporium]
5FNE_A	5.90e-28	238	480	33	283	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Triple Mutant E37k, H39r & G330r [Pleurotus eryngii]
3FMU_A	8.07e-28	238	480	33	283	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0IW58|LNP_TAICA	3.02e-31	238	480	33	290	Low-redox potential peroxidase OS=Taiwanofungus camphoratus OX=2696576 GN=LnP PE=1 SV=1
sp|P49012|LIG2_PHACH	4.33e-27	238	480	61	318	Ligninase LG2 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG2 PE=1 SV=1
sp|Q9UR19|VPL1_PLEER	1.76e-26	238	480	63	313	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1
sp|O94753|VPL2_PLEER	2.40e-26	238	480	63	313	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1
sp|P11543|LIG5_PHACH	2.44e-25	238	480	60	316	Ligninase LG5 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_1.1277.mRNA-p1.