CAZyme Information: ZTRI_1.1158.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1158.mRNA-p1
• CAZy Family: AA1
• CAZyme Description: similar to glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
990		110016.90	7.4770

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:3331016-3334237(-)

Full Sequence      

MLSTFPRNASPTTLPRSDLVIPAVLFLDSILVDLNPLSASWVYPHGLLIRAAAWAILGGV
LTIKVGVQGLLDVKNAKRRTAWLVAGLLVLAQVCERSVEDHGGREILLAQALLPALIWLS
FGGDAIGDDESAMIIPLEHDRSRATSPTKQKQIVERTAPRGSSPPRVSSVKLAIITAAAS
VAVHTSSGDKSLSALALSYGVIQALAFRIFEGVRNRTSQRDREGSEGGQSTEAWSDNTLL
IMIRDVAAAATLFATTAAFMLESMKFGSLQHHGRFSDFGIGVRSVGMSWGTMILQAIMCG
LQLVVVFRHGAFIASFVPLAAAVCSQLLLSFSPSRLWFSGICLLSLFDERSAFAGSRMKF
RFSRILGLVALLSFAVLAIYRLRQPLTVQNTPLVVPVSGLNATLPETPLDPLQYGESHVH
PIKSLVQDAQASWQKKLESQSKTLAEAVREYQRRYGIPPPPHFDKWYAFAKSKDVQLIDE
YDTIYHSLLPFWALSPATIRARTREALGFADNNLMGLLIRNGAVVHAEGGQDWLQEAAAG
MMAPFLNYLPDLDLAFNTHDEPRVVVPHDELARLIQLALETNMPKIAAQPSLKNAYSRRA
ADLGPGKRIGEVKTTRFNVFSHQATWIPSRMSCSPDSPARALEESLEHDNLTAYALGDLG
FVYNQTAFSDICNSPSFGKSHGFFDRPNAFSVVHDLFPIFSQSKMSSFQDIVFPSPWYWF
GKVKYDGDKDKPWTAKENRLWWRGSTTGGFSRAGGWKRQHRQNFVRRVNALGEAKILMNS
NAAATDENPESKWITKTVSRQDFKEIIDVHFTHVGQCDPGDCDAQREFFDLAPPADQQDA
WNYKYLLDLDGNAFSGRFYAFLMSHSLTFKMAVFREWHEEWIKPWVHYIPLSLRADEALE
AVRFFDAEEEGRPLAIAVAEQGREWAGRALRNEDFEVWFFRLLLEYVAPTTFQSRVMLTS
SVTGMAGSWMTIGMRSDSLVHSVCCLVSVA

Enzyme Prediction     

No EC number prediction in ZTRI_1.1158.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	682	947	1.7e-78	0.94

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.27e-22	694	947	28	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.40e-11	698	946	108	319	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR44599.1|GT90	0.0	1	946	1	946
SMQ46076.1|GT90	0.0	1	946	1	945
SMR42421.1|GT90	0.0	1	946	1	945
SMY19760.1|GT90	0.0	1	946	1	945
UJO10778.1|GT90	0.0	17	946	18	943

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.83e-09	602	947	71	376	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	5.90e-08	685	946	105	338	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.08e-53	420	951	152	657	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	5.51e-09	698	953	164	392	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	9.74e-09	602	947	83	388	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.18e-07	832	946	268	385	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.49e-07	685	946	133	366	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000001

TMHMM  Annotations     

Start	End
49	71
239	261
285	307
360	382