CAZyme Information: ZTRI_1.1116.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_1.1116.mRNA-p1
• CAZy Family: AA1
• CAZyme Description: similar to DUF821 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		49388.17	7.8148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_1:3214099-3215436(-)

Full Sequence      

MNPVVWKIVSGVLLLCVLVQQYGAQTPFVRLRAAAPSKQESHKEAHRTATSWTFDPARDR
DNHGLTTEQCDAAFPELYHQIDISLDHWKGTKIESDNIKLLGGNDGGVRFLIHDQQLRII
ETRGLHREDFRHRIIAIAQQILRAIAAAEAANEPLPDIEFTIIVDDKPYLHKDPSAALWS
FAKQQANKIHDSIWLVPDFHFFGAPPEAESFRLMQTRARQHDAPLERKIPKVVWRGVEWT
NQNLRKPLLKVTAGRPWADVEAMKWKDPNSVIPMDEFCKYRYVVNTEGRSWSARLTHLLN
CDSLVLVHDVEWVAHYYHLFDTLNNCVRVERDWSDLESTIAYYDKNLDEAQKIANRTKEM
FRDRYTTPAATACYWRKLMRAWSTVAFEPKVIDETKKGTIRLRGTSFEEFIVHDNTRDYP
YRAKAG

Enzyme Prediction     

No EC number prediction in ZTRI_1.1116.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	155	385	1.7e-25	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.64e-25	154	383	1	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.34e-18	75	391	7	329	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW51979.1|GT90	6.81e-72	48	412	66	448
QLI69899.1|GT0	1.31e-65	51	412	80	448
QRC91380.1|GT0	2.40e-63	37	426	89	490
CAE7205608.1|GT0	9.19e-62	52	414	107	475
UDD61446.1|GT0	1.11e-61	21	412	33	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	4.78e-09	155	394	128	388	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	6.09e-12	155	394	137	398	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.43e-10	155	390	138	393	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q7ZVE6|PLGT2_DANRE	7.62e-10	70	393	152	474	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q9JHP7|PLGT2_MOUSE	4.18e-09	76	397	155	479	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1
sp|Q7Z4H8|PLGT3_HUMAN	5.59e-09	276	393	363	480	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.130273	0.869701	CS pos: 24-25. Pr: 0.7900

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_1.1116.mRNA-p1.