CAZyme Information: Z517_12415-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_12415-t43_1-p1
• CAZy Family: GT91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	KN846977|CGC3	47333.19	9.3790

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846977:867866-869333(-)

Full Sequence      

MRVAWLSSRQFLRRFVASVVLSAFAIWYLLLPDPKHRVQTQPEVLERQYPLLWRHVHSFN
GTGGAWYIPPSWLSSASVQPETIVDAALLAAQAANTNKHRFINQSSIPLLLHQTWKNRRV
DTWSDLLRASVEKWLSCVVADDMAYFFWEDEGIVRMLAEFEPDFVHRFVSLPSNVERADV
FRVLVLKWFGGIYADVDTRPLRRPVSWVSASDLAPWTDAVTGLKYSYDNTVSTILGIEAD
CVPYKSDYWRMGYSYPVQLTQWALASSPGHPILLRFMDTLQRRLADVARRDRGDITAPQA
VRELQRIGPLSLTGPVSVTVAAKTWLEERIGLRWNALTGLADGGQSKLVDDVLILPITGF
SPGRGKYGNMGSKPVTDSSARVWHQAQGSWRSFDPKVEFGKACRTLLGLCKDWSKQPD

Enzyme Prediction     

No EC number prediction in Z517_12415-t43_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.44e-16	107	296	82	263	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.14e-08	124	207	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX57092.1|GT32	3.42e-164	9	415	9	414
QGA12609.1|GT32	2.61e-160	34	415	39	420
BCR93027.1|GT32	9.24e-159	18	417	10	408
BCS05686.1|GT32	9.24e-159	18	417	10	408
CAK38082.1|GT32	1.23e-156	18	417	10	408

PDB Hits     

Z517_12415-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.20e-23	105	391	140	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.57e-19	102	391	111	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.33e-13	103	391	92	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.83e-13	97	254	46	205	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P47124|HOC1_YEAST	1.33e-12	162	361	183	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000035

TMHMM  Annotations     

Start	End
12	31