CAZyme Information: Z517_12155-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_12155-t43_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569		62249.22	6.4178

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846977:131194-132963(-)

Full Sequence      

MSPSMPDRFDFIVVGAGAAGAILAARLANSKHRPSVLLIEAGGKNDSKDVRADAERWLHR
MIPSQNWGYKTAPIKGFGGNIIDYDRGKGLGGSTAINFSVWTVGPKDDYDQIANLVGDDE
WSWNNAQKRYKRLESFHATAPNVPGDAKRYLNPDPKDHGHDGPIKVGFPQVWEPSCTALM
DIWYANGTKPNADHNSGDPIGLAACVSSAYKGIRSTSADALVGAPSNLHVLVDAEVAQVT
FDGTKATGIKTTGGKVFQADKEVILSCGALDTPRILMHSGIGPVDELSSFNIPILKANEN
VGRHLKDHHHIMIPSLRADHTSERTRFYKNKELQAAARAAWEKDGTGPLAEYGCALGIAY
LKLDKLYDSAEFQALPKEDQEKLRKPTVPHYEFLLNAAWLPNFIDPENAQAGTTVFVFIL
NQMSTGAVRLQSSDPTKPLIFDPNFFSHPFDRRVAVEATRDVLRVLKSPEFQKDTLAIDG
PKSESEDDILAFWRAGSASTWHMMGTARMGKDEDKAVVDNHFKVFGVENLRVADMSVIPI
VSNNHTQSTAYLVGLTAADKLVEEYGLDG

Enzyme Prediction     

No EC number prediction in Z517_12155-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	563	3.3e-150	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.48e-80	35	564	32	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.59e-53	35	560	31	530	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.03e-42	424	557	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.15e-29	212	554	218	569	Protein HOTHEAD
366272	GMC_oxred_N	7.06e-24	78	308	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI63764.1|AA3_2	2.18e-186	7	567	4	564
QMW33321.1|AA3_2	1.20e-185	5	567	1	563
QMW45359.1|AA3_2	1.70e-185	5	567	1	563
UDD61192.1|AA3_2	1.70e-185	5	567	1	563
BCR99292.1|AA3_2	2.23e-185	4	568	3	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	2.95e-63	9	559	3	560	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	4.02e-63	9	559	2	559	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3Q9T_A	3.24e-53	7	565	5	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.47e-53	7	565	5	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	6.18e-53	7	565	5	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	4.08e-59	3	565	36	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q5B8A1|PKFF_EMENI	4.98e-59	9	559	41	605	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|V5NC32|PDH1_AGAXA	5.04e-54	8	565	40	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q3L1D1|PDH1_AGABI	1.16e-52	9	565	41	593	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|Q3L243|PDH2_LEUMG	6.42e-52	3	565	36	599	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999807	0.000225

TMHMM  Annotations     

There is no transmembrane helices in Z517_12155-t43_1-p1.