CAZyme Information: Z517_12071-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_12071-t43_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	KN846976|CGC4	44921.04	6.0179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846976:2083354-2084728(-)

Full Sequence      

MRATNLHLAALCAPVVLAIPHGGNHRHQHPARHHIETDFATVTDVVTVTANNAVVWVDQY
NNVLSTEYRDHPTPTTVASQSAATPVVVPTAYTPPPGRASPFHVESASHASESPASVLVP
TPESAPPAPPAPSSQVAVSSPPPVVSVIQPSTSSDTPSSEKSVAAAADKGNSYKGVKGGA
SAGAGGGYGICYELIGSNGCKDRGTMDSEFGFLANQGFSKIRFYDIGCDLSVATAAAAAQ
GLQVMLGLNTIGNVAGDLSTLIGMINGNWGPVDTIVIGNEVVNAGGSAAAVVAALAVARP
ILQAAGFNKNIVAVDTFTAHQNNPQICQSSDFCAVNAHAFFDPNTAANNAGTFVESVIAP
ISQKANGKQVIVTESGWPYQGSPNGQAVPSPANQASAISSLKDAFSSNPGGIFLFQAYDA
TYKAPGAFGVEQYFGIYGH

Enzyme Prediction     

No EC number prediction in Z517_12071-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	189	437	5.2e-20	0.954983922829582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.54e-43	190	437	48	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.46e-04	311	437	172	297	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69160.1|GH17	1.59e-54	185	437	152	407
QSS63389.1|GH17	5.37e-54	185	436	133	387
QSS51160.1|GH17	6.10e-54	185	436	152	406
SMY28743.1|GH17	3.50e-53	187	439	129	380
ANB15075.1|GH17	4.83e-52	182	439	136	391

PDB Hits     

Z517_12071-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	6.04e-44	183	437	122	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	7.89e-42	184	436	133	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	3.82e-38	189	436	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	6.81e-30	190	436	284	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q4WC60|BTGE_ASPFU	1.25e-28	200	437	322	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999735	CS pos: 18-19. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in Z517_12071-t43_1-p1.