CAZyme Information: Z517_11865-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_11865-t43_1-p1
• CAZy Family: GT50
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	KN846976|CGC8	61756.40	6.3113

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846976:1535717-1537556(+)

Full Sequence      

MPSVNDSPSKVESRLLLVSNRLPITIKRSPEGKYDFSMSSGGLVTGLSGLAKSTKFQWYG
WPGLEVPEDEAGGVVKRLKDEFDAIPVFVDDELADRHYNGFSNSIMWPLFHYHPGEITFD
ESAWNAYSEVNRLFARAIAKEVEDGDLVWVHDYHLMLLPQMLREEIGSTKSNVKIGFFLH
TPFPSSEIYRILPVRNEILLGVLHCDLIGFHTYDYARHFLSSCSRILNLTTTPNGVEFEG
KVVTVGAFPIGIDPEKFTEGLKKEKVQKRIAVLEEKFKGVKLIVGVDRLDYIKGVPQKLH
ALEVFLTDHPEWIGKVVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGKFGTVEFMPIHF
MHKSVNFDELIALYAVSDVCLVSSTRDGMNLVSFEYIASQEQRKGVLILSEFAGAAQSLN
GSILVNPWNTEELASAIQEAVTMSPEHRAINYAKLHKYVFKYTSAFWGQSFVAELTRISA
QGEKKLKLRRASLIKSPSQQPPSENRDGESQSKPASQPSQPTTKADVEIDGHPASRDDVA
AADGISKEKSATI

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	6	477	9.3e-202	0.9873684210526316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215555	PLN03063	0.0	14	506	12	508	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	0.0	14	475	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	13	477	1	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	0.0	13	490	1	474	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	0.0	2	481	5	483	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51129.1|GT20	1.21e-316	1	494	1	493
QSS69129.1|GT20	7.17e-316	1	494	1	493
QSS63365.1|GT20	6.86e-314	1	494	1	493
QRD82299.1|GT20	1.15e-312	1	493	1	492
QMW27863.1|GT20	1.15e-312	1	493	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	1.35e-311	1	517	1	515	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.56e-293	14	478	1	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.07e-278	1	480	1	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	2.11e-252	11	481	2	473	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	8.58e-252	11	481	2	473	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WLM9|TPS1A_ASPFU	6.97e-311	1	517	1	515	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsA PE=1 SV=1
sp|Q00075|TPS1A_ASPNG	1.24e-309	1	493	1	493	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1
sp|O59921|TPS1_EMENI	8.43e-307	1	486	1	485	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tpsA PE=3 SV=1
sp|A0A384JAD8|TPS1_BOTFB	1.91e-296	1	485	1	485	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TPS1 PE=1 SV=1
sp|Q00217|TPS1B_ASPNG	2.00e-278	3	479	2	479	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aspergillus niger OX=5061 GN=tpsB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Z517_11865-t43_1-p1.