CAZyme Information: Z517_11095-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_11095-t43_1-p1
• CAZy Family: GT32
• CAZyme Description: chitin synthase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
921	KN846975|CGC2	104751.44	6.9215

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:2914971-2917836(-)

Full Sequence      

MAYNPIRDPQRDPYSPGMNPQYDSRSPSPGRPLQPYTHPDEAHSRQQIPLQMPTASNDRL
AMQPTYSVENIPHSYGHNQQYEQQLPVGPGGDMGYGRNDYIVSPEEHHDAYYTQSYSPHP
QGDYALDPYPTADQPYRLDSDHDPILQSDNSYGPDPHGQDEMNYDGYQDEQRPTPSPAPI
RRWKTVKEVQLFNGNLVLDCPVPPKLLANVPHAQPPERDEFTHMRYSAATCDPSDFYSER
FTLRQRLFAKPRETELFIVVTMYNEDEFLFARTMIGVFKNIEFMCNRNSSKTWGKEAWKK
IVVCIVSDGRAKINPRTRAVLAGLGVYQDGIAKQQVNGKDVTAHIYEYTTQVGLELKGTQ
VSLKPRSATPVQLLFCLKEKNQKKINSHRWFFQAFGQVLEPNICVLIDAGTKPGKDSIYH
LWKAFDLEPSCGGACGEIKVMLDHGKKLYNPLVATQNFEYKMSNILDKPLESAFGFISVL
PGAFSAYRYIALQNDKNGEGPLEKYFKGETMHADAGVFTANMYLAEDRILCFELVSKRNC
QWILQYVKSATGETDVPDGIAEFILQRRRWLNGSFFAAVYAVAHVYQLWRSNHSAIRKFM
FLVEFTYQTINMLFAWFAIGNFFLVFRLLTSSLGSPGPLGRTGTVLGVIFEFIYLGTLLY
CFILSMGNRPQGSKKSYLAMVIFWSILMIWLTFASIFLTVKSIQTEVNQKDFSFSTIFNN
STFFGLIVSLASTYVLWFVASFLFFDPWHMFTCFLQYIVLTPTYINVLNIYAFCNTHDIT
WGTKGDDKAEKLPSANVKPGGMVDVTIPQDDGDLNAQYDAELKRFATKAEKEVSKQSPAD
KQEDYYKSFRSNVVTAWMITNFILVAAVLNISGFERIDTGDTAQQNSTIYLAVILWSVAG
LSLFRFTGACWFLIVRMFRGV

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	262	425	3.2e-76	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.75e-109	262	425	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	8.74e-103	258	577	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.72e-35	188	261	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.38e-28	374	698	115	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	9.76e-16	373	492	55	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAC34496.1|GT2|2.4.1.16	0.0	1	917	1	917
AAF82801.1|GT2|2.4.1.16	0.0	1	917	1	910
QSS55730.1|GT2	0.0	1	921	1	916
QSS72325.1|GT2	0.0	1	921	1	916
BAB85684.1|GT2	0.0	14	921	17	920

PDB Hits     

Z517_11095-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30601|CHS2_EXODE	0.0	1	917	1	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30588|CHS3_NEUCR	0.0	52	921	5	888	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30583|CHSC_EMENI	0.0	1	921	1	918	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|Q12564|CHSA_AMPQU	0.0	60	917	39	898	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1
sp|P87073|CHS1_PHYB8	1.93e-295	127	920	32	841	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
570	589
610	629
644	666
678	700
722	744
751	773
853	872
893	915