CAZyme Information: Z517_11079-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_11079-t43_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		51239.88	4.3526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:2874119-2875692(-)

Full Sequence      

MRNLVVTVFAAGASAWTYAPNITYSAAISINALQTYQTMIGGGCSGAFGIACHQFGSVGL
SPANQEIVTQILFDENIGGLSIVRNDIGSTPGHVPGDVASILPVCPPTPEGPFNYVWDRN
DTCQLQLTQTALKYNPNVYVYADAWSAPGCMKTVGTEDEGGLICGVRGSTNCSGDWRQAY
ADYLVQYVKFYEQEGIEVSLLGAYNEPDFNPVTYASMESDGYQAKDFLEFLYPTAKAAFP
NISVSCCDATGARQERNILYELQQAGGADLFDVATWHNYQSNPERPFNSNGKPNLMTEWA
DGSGPWNANWDVSGQLAEGFQWAMYMHNAFVNSDTSGYTHWWCAQNTTNDNALIRLNHDS
YFVSARLWAFASYFRFARPGSVRIGATSSAENVYVSAYVNTNGTVAIPVINEAHFPYQLT
IDLSGVNASTATAYLTDNQHNVTMVGQTQVGGAVFEATIEPRAVKTFFLS

Enzyme Prediction     

EC	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	26	467	9.3e-160	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	1.60e-22	25	467	33	426	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
307945	Glyco_hydro_30	2.10e-10	60	238	19	193	Glycosyl hydrolase family 30 TIM-barrel domain.
407314	Glyco_hydro_30C	1.47e-05	380	467	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57081.1|GH30_7	2.45e-263	14	469	16	464
UKZ82812.1|GH30_7	2.45e-263	14	469	16	464
AAV25955.1|GH30_7|3.2.1.-	4.94e-263	5	469	7	464
AAP64786.1|GH30_7|3.2.1.-	4.94e-263	5	469	7	464
UKZ94643.1|GH30_7	7.02e-263	14	469	16	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	1.17e-94	26	467	22	469	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.19e-93	28	467	95	540	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
6M5Z_A	9.67e-77	28	470	25	454	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	1.36e-75	28	469	5	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	2.30e-74	28	469	12	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	1.76e-75	28	469	29	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q45070|XYNC_BACSU	2.61e-12	124	470	97	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
sp|Q6YK37|XYNC_BACIU	5.93e-10	124	467	98	419	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
sp|O16580|GLCM1_CAEEL	2.86e-08	129	412	182	482	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.373545	0.626464	CS pos: 17-18. Pr: 0.3964

TMHMM  Annotations     

There is no transmembrane helices in Z517_11079-t43_1-p1.