CAZyme Information: Z517_10949-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_10949-t43_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		40855.44	6.2238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:2489940-2490992(-)

Full Sequence      

MAILTVSPEKRCWVTLVTKPSYLPGVVVLAHTLDQHKSSHPLLVQYTHSLGDKALDVLQQ
EAKHSGRIQLQRVPLLLPRKDQENTGSVAERFKDTFTKLRAFEIYKLGFTKAVFLDADMA
IFQNPDDIFECSLPGREWIGANHACVCNLDSDPWAPSEWHKGNCAYTPLNHPNEVAPAMT
SESRPTYHLLNSGMFLFYPSEQLWDRMLRFFNSSDELKNYQFPDQDFLADFFRGKWHPLS
WKYNALKTMRYWHPRMWSDDTLVILHYIVDKPWERQLSQDGLAGHLGRDGDTHQWWWDMY
HEWRQQRQRIDPTGIVVVTMEELVDTEEPFTKMVPLPQDVGKPEDVLPYP

Enzyme Prediction     

No EC number prediction in Z517_10949-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	10	275	1.4e-38	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	6.38e-63	13	303	3	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	1.71e-15	5	302	17	293	galactinol synthase
279798	Glyco_transf_8	3.47e-12	22	273	10	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133037	GT8_A4GalT_like	3.69e-10	111	273	98	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
227884	Gnt1	2.63e-06	22	286	83	360	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYG85442.1|GT8	2.18e-112	9	313	4	309
QIW98437.1|GT8	5.48e-98	9	316	8	316
QPC59317.1|GT8	1.16e-97	5	307	6	307
QPC70693.1|GT8	3.30e-97	5	307	6	307
UJO10948.1|GT8	7.29e-97	7	302	12	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZCT_A	2.15e-06	11	232	24	191	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V8Y_A	2.16e-06	11	232	24	191	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]
3USR_A	2.16e-06	11	232	24	191	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3USQ_A	2.16e-06	11	192	24	189	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1LL2_A	2.54e-06	11	232	4	171	Crystal Structure of Rabbit Muscle Glycogenin Complexed with UDP-glucose and Manganese [Oryctolagus cuniculus],1LL3_A Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	5.26e-15	5	302	14	280	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|O22693|GOLS4_ARATH	1.69e-13	7	302	19	294	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Z517_10949-t43_1-p1.