CAZyme Information: Z517_10828-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_10828-t43_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		90148.50	5.2488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:2138476-2140869(+)

Full Sequence      

MLSYASGSVAFGHLRPFIFTLFSLCSWVAHASNDTLLWGPYRPNLYFGVRPRVPNSLLTG
LLWANTDNYGSAQLNFRHTCEQHEGMAGYGWEEYDVRNGGRQVIHDTGNKIDLTIDFVKI
AGGEHGGNWAVRIKGNPREDAPPTLVTTLIFYAGMEGLGELAFTSIEEEDGVVTLHGDTS
ELGQFDISFEDSPENLLPYKIHPSWDSKPVDRPLLCSHQIPPEAIWQAKNIAFASMKSEI
DTLIQQYGQENMPPPWQAFSIPHNPGPGNFHMVQKIFVGAFETDIRFKSGSGPAVSSESL
TKSIASASKEFTKKFKEVFKPLAPFTKPAYTDFSASMFSNLFGGIGYFYGDSLVDRSYAP
EYDEDNEGFWEETAAARARAQIVNDPPAELFTSVPSRPFFPRGFLWDEGFHLIPIADWDL
DVTIDIVKSWFNLIDQDGWIAREQILGPEARSKVPPEFQVQYPHYANPPTLFLIVDILMD
KMSSPAYAASKEHIESELRNLYPLLKRQYYWFRRTQFGDIKSYDREAFSTKEAYRWRGRT
PQHILPSGLDDYPRPQPPHPGELHVDLISWVGMMSRILVRLSTLLSEADDIPDFKSQHKA
IVRNIDDLHWSSEQKCYCDATIDDYEDSVHVCHKGYISLFPFMTGLLPANHPHLPDVLDL
ISSPSELWSPHGIRSLSKSDTFYGTDENYWRSPVWVNMNYLILRSLLNVVQSADPAPPAK
VKAQAQRIYTDLRKNLVETVFSEWARTGFAWEQYNPETGEGQRTQHFTGWTSLVVVIMRM
PDLSGGSGSSGVQHGEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	562	779	2.1e-28	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	296	780	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.32e-111	36	254	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	3.89e-09	440	709	304	551	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	7.10e-04	565	772	578	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12625.1|GH63	0.0	30	787	42	810
BCS02288.1|GH63	0.0	24	783	32	811
BCS13967.1|GH63	0.0	24	783	32	811
QKX57094.1|GH63	0.0	28	797	464	1253
CAL00956.1|GH63	0.0	24	783	32	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.77e-166	32	778	11	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	2.90e-129	31	778	32	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	7.12e-225	28	778	34	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	3.68e-165	32	778	41	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	5.35e-129	31	778	87	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	3.54e-125	31	778	87	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	5.70e-124	31	778	89	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004445	0.995508	CS pos: 31-32. Pr: 0.9599

TMHMM  Annotations     

There is no transmembrane helices in Z517_10828-t43_1-p1.