CAZyme Information: Z517_10591-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_10591-t43_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	KN846975|CGC4	58324.92	4.3329

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:1486159-1487874(-)

Full Sequence      

MRRTNNIGVLALGLASSIQGISAGPTWPSAYDEIEDLMFLNNGYNAREFPILLQPCTIAK
EPGHSIAAGLIRTAFHDMAPHDASTGVGGVDASIGFELDSNIYPTNTGIAFNNTLHFYSQ
FFSSRAPMADLINVGLYQAVRACGGPIVPVRAGRVDATGPGPVGVPQPTDPMPQMIGEFR
RMGFSPEEMVAMVACGHSIGGVHSEEHPDIVPPGSTPLGVQDLDSTNATFDNAVVTEYLD
GTTRNPLVVGANPKAYSDGRIFGLNDRQTVSGLADPYAYANACSGIFAKMINTVPAGVQL
SDVIAPYELKPSNLQLNVAADGQNLQFTGELRIHTNSLPSSSISSVQVVYKDRTGAASDG
YTIQASVLGDANGFDDTFTFYGFEGTIPASTSISSFTVIVSLTSGSTQTFDNNGQGYAIS
DKIFAQTSYSSLAAADASGNQQLTVYAAARTGETYDPVTLSVDLINPITYNDLPTVSSVP
TPMTSVCAGQYYTFYSATFGVPAAGANFTKYDVSTSSNEETVLDSFKSLAGLPLTASASP
SCSGSWNKRAVNFSA

Enzyme Prediction     

No EC number prediction in Z517_10591-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	64	248	3.5e-27	0.6901960784313725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	1.52e-112	27	292	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	4.22e-24	65	292	16	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	7.44e-22	65	205	14	157	Peroxidase.
173825	ascorbate_peroxidase	1.66e-16	70	241	33	196	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173826	ligninase	1.63e-13	71	257	42	225	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57066.1|AA0	1.37e-123	21	532	20	531
QGA18666.1|AA5_1	7.45e-122	9	539	6	531
VBB76056.1|AA0	1.51e-112	3	521	4	521
QRV94524.1|AA2	4.59e-95	9	527	4	523
QRV79935.1|AA2	5.95e-92	9	527	4	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q3U_A	2.34e-06	71	239	43	209	Trametes cervina lignin peroxidase [Trametopsis cervina]
3FMU_A	7.09e-06	71	237	42	200	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	2.57e-122	7	535	3	511	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	3.70e-11	38	200	87	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|A4R606|CCPR2_MAGO7	4.29e-06	70	203	33	169	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000308	0.999649	CS pos: 23-24. Pr: 0.9676

TMHMM  Annotations     

There is no transmembrane helices in Z517_10591-t43_1-p1.