CAZyme Information: Z517_10452-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_10452-t43_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		64707.24	6.1289

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:1076146-1078021(-)

Full Sequence      

MVHPATAPKGAPQAFDFIVVGGGTAGCVVAGRLAENPKVSILVIEAGINNTSEIPEISTP
ARAFELRGSQYDWGYKTTMINRPDYTRVEKPNTRGKMLGGSSGGNYYTWVRGSAATFDDW
AEYGTDEWNWENTKAYFNKSTTYHDDDNLYSTDLAKIGNLGGPLHISHSDLIPELKPFRD
ALETAWVSKGQELTSDVYSGTQKGLFKCVNSIYKGVRSTAAVFLEGKPNVTLMSSTISKK
LVFEGNKAVGVTVIGPDGQDYTFHAKYEVIVSQGVFESPKLLMLSGIGPKEHLESKGIKT
LVDSQHVGQNLLDHPILSHVFKIKDGYGLDSHLLRAGPQKDGAVAAYRKDRTGPYSSGLL
ELVAFPRADEWFETSKEYREYKAKNGGVDPFGPGGQPHFEVDFVPMFCDAFQWHFPTPPQ
GDYLTVIVDLMRPLSRNGEVKLNSTDPKEQPYVNINFFSHDLDLIALREGVRMIDDIVMN
GEGMKDIIEGDYPWPMPRNSDEAMIRQILERSQTGFHPCGTARLSKDIKQGVVNPKLQVH
GTSGLRVIDASVFPVIPDCRIQNDVYMVAEKGADMIKAEYPSLYK

Enzyme Prediction     

No EC number prediction in Z517_10452-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	578	1.3e-153	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.64e-105	13	577	4	532	choline dehydrogenase; Validated
225186	BetA	4.68e-89	15	581	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.81e-41	433	571	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.63e-26	4	568	45	568	Protein HOTHEAD
366272	GMC_oxred_N	3.99e-24	94	316	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB24176.1|AA3_2	0.0	1	585	1	585
AFR94515.1|AA3_2	0.0	1	585	1	585
KGB80031.1|AA3_2	0.0	1	585	1	585
UOH84707.1|AA3_2	3.28e-315	1	585	1	568
BCS02092.1|AA3_2	9.76e-305	13	585	7	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.52e-256	15	584	7	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.35e-256	15	584	7	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.24e-255	15	584	7	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.95e-68	15	579	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.05e-67	15	579	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	2.45e-65	13	576	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.43e-62	15	577	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q8G1Z8|BETA_BRUSU	2.10e-62	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|C3MIE4|BETA_SINFN	1.09e-61	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1
sp|Q8UH55|BETA_AGRFC	1.52e-61	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999949	0.000118

TMHMM  Annotations     

There is no transmembrane helices in Z517_10452-t43_1-p1.