CAZyme Information: Z517_10232-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_10232-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		64535.34	6.3129

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:447523-449857(+)

Full Sequence      

MSPGRIVADNDYDFIVCGGGTAGCVVAGRLAEDDNARVLVVEAGPHNKDLENVHMTGGWS
KNFDSDLDWNLVTPPMAGVNGRQVKLSRGKFLGGSSGVNGTLCIRGNKQDYDDWKLPGWS
GEDFFKYMRKKAETFHPKPWFQTDEKAHGYNGPLHTEPHDLAPISNLLLESMEDMGFPLV
HDMFSNGETPHGCGHVPRTVHKGIRTTGADFVTNDQHKTNIDLLLDTVVDKINFEEKDGE
LHATSVVLVGKDGTTREVRATKEIIVSGGAYCSPAILLRSGIGPKAELEELGIQCLVDSQ
GVGKNLLDHLIVFAFYEVTKEGLTNDHLVYHGDAAMAAYMLYKEKKEGILSTFPFGAFAF
ARLDDRLKDEPLWKEAKREPGRDPMGLTPKQPNIEFFTTELYGGPKQYDQFPIDKKHAFA
MITELFSPRSRGTVTLKSKDPLENPVVDCNYLADPLDMLVLSEGCRLGNEIVMNLNKVAK
QEIVKGSWPSDLTHHTYTKREEWEPYVRKEATTCYHAAGTCKMGRDGDKMAVLDEKLQVR
GVKGLRVADTSVMPTLHGGHTQMPAYGIGEKAADLIKARWSKV

Enzyme Prediction     

No EC number prediction in Z517_10232-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	578	7.6e-162	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.55e-104	8	579	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.72e-104	8	579	2	534	choline dehydrogenase; Validated
274888	Rv0697	1.12e-62	13	576	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	4.13e-41	428	572	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.02e-34	79	311	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48130.1|AA3_2	4.91e-317	8	581	5	575
QMW36070.1|AA3_2	4.91e-317	8	581	5	575
UDD65288.1|AA3_2	3.83e-316	8	581	5	575
AFB81353.1|AA3_2	1.50e-309	9	580	8	576
QRD92967.1|AA3_2	3.71e-309	8	581	5	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	7.38e-75	12	578	7	571	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.03e-74	12	578	7	571	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.44e-74	12	578	7	571	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	2.08e-69	3	576	32	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6YS1_AAA	9.65e-66	7	579	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P18172|DHGL_DROPS	1.87e-77	5	580	58	608	Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Gld PE=3 SV=4
sp|P18173|DHGL_DROME	2.08e-74	5	580	58	608	Glucose dehydrogenase [FAD, quinone] OS=Drosophila melanogaster OX=7227 GN=Gld PE=3 SV=3
sp|Q47944|SDH_GLUOY	4.89e-74	12	577	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	4.39e-73	11	579	4	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	1.77e-71	12	576	5	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000039

TMHMM  Annotations     

There is no transmembrane helices in Z517_10232-t43_1-p1.