CAZyme Information: Z517_10194-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_10194-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		41936.73	6.3441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846975:350816-351928(-)

Full Sequence      

MAISHSWRRAVLATIVLLTLFLLLRHVSLSPSIPSAEGAAAGKQASRPYPPPKSPNVVQE
FQQAVQDVKGRPLQERLRYHFPYDMESKFPAYIWQTWKYGPDSGNFEERLRPFEASWSNL
HPGFVHEVVTDDAALHLINYLYASMPEIVQAYEAMPLPVIRADFFRYLILLARGGIYSDI
DTQALQSATDWLPQTLDKSTVGLVVGIEADPDRPDWNQWYARRIQFCQWTIQAKPGHPVL
RDIVATITEDTLAMQKAGRLRKGREPAKSIMEYTGPGVWTDALFSYFNNQEYFDFSNRKT
NVSYSDFFAITEHKKIGDVVVLPITSFSPGVGQMGSEGPEHPMAFVRHDFDGMWSLALEQ
DAAKAATYML

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	115	194	1.9e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.86e-41	73	357	66	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.84e-19	116	195	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07268.1|GT32	2.57e-148	6	354	3	356
BCR94678.1|GT32	2.57e-148	6	354	3	356
CAK39413.1|GT32	1.48e-147	6	354	3	356
QKX63547.1|GT32	1.48e-146	59	354	63	356
QVM11372.1|GT32	2.03e-146	65	354	60	352

PDB Hits     

Z517_10194-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	9.34e-93	73	354	83	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	8.46e-82	79	354	132	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.82e-74	61	354	98	387	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.05e-71	73	366	80	477	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000002

TMHMM  Annotations     

Start	End
7	29