CAZyme Information: Z517_09781-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_09781-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		34641.67	7.7753

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846974:2610491-2611793(-)

Full Sequence      

MSSEAPTKRNWVNVVAAYCGRRGTKKAQGPSLLTAENNATTTSEAQPSSIKNPSGHDEVK
ADGDGWLVPGVGRFSKRAVYTFEGQSLPEGLMKSNYTVRCKNWTGIPFNKRFDPANVRCF
RGFLRLAVPGAQKPSKQTGYAVSCAEVTTVEEKILYGSFRTTAVFSTEPGTCHGIFFYKD
DTQECDIEYVTDPTSLSNNGPNAPIPLWYTNQAIDPTKMDKSCESGPAPSSCTTRTHEYR
IDWTPDFTAFYIDGVCQKNFTNNIPNVPGQLVWNNWTNGDKGWAVGPPNRENVFKIKKIV
MYYDTATSESGDSG

Enzyme Prediction     

No EC number prediction in Z517_09781-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	137	302	1.1e-40	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.76e-33	102	302	17	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185692	GH16_fungal_CRH1_transglycosylase	8.78e-05	154	255	45	136	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185687	GH16_beta_agarase	5.27e-04	82	255	29	201	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
185684	GH16_lichenase	5.33e-04	103	289	19	196	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	5.48e-04	237	278	105	157	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62486.1|GH16	7.51e-66	58	306	31	263
CEI62369.1|GH16	1.06e-65	60	306	33	263
CZS81947.1|GH16	4.94e-64	66	306	40	264
CEF78656.1|GH16	4.94e-64	66	306	40	264
QPC59862.1|GH16	6.98e-64	66	306	40	264

PDB Hits     

Z517_09781-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Z517_09781-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Z517_09781-t43_1-p1.