CAZyme Information: Z517_08982-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_08982-t43_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877		95116.77	7.4521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846973:4142205-4145139(+)

Full Sequence      

MGQKENLSRLPTAAPPSLQLSTTDVNANENAYPDEPDSPLPDAFAEDATDVLDDGRISLN
LNSKLAQVFAQLVEASEDDEEVAEPPPAYSSILDIDSWKLPLNIVIQIVGSRGDVQPFVA
LGQELQRHGHRVRLATHSAFRNFVETAGLEFYSIGGDPAELMAYMVKNPGLLPRMKALRE
GDVKKNRQMIREILDGCWASCILPSDGGEPFVANAIIANPPSFAHVHCAQALGVPLHIMF
TMPWSPTRAFPHPLANIKNSSTDPRLANYISYGMVQLLTWNGIGDIVQKWRKSIGLESVP
MSEAPFLMETLQVPHTYCWSPALVSKPTDWGKHIDICGFLRRDPVSFTIPDGLEQFLRSG
PTPIYVGFGSIVVENPGRLLHIVLAAIKACGVRAIISKGWSNLESENVGENIYFLGDCPH
EWLFQQVSVVVHHGGAGTTATGLMNGCPTVIVPFFGDQLFWGNVVAASQAGPPPIAHKKL
NSKNLSDSIRYCLRQETQQAAKEVADRMAAEEGVKAAVRSFHRHLPVDDMNCDLIKGLPA
TWVYKRSKTLLKVSGPAAEILILAQRIKADHLRLYKPKPITIENRRWNFLTSSVAVSMEL
SYDILGAISGFWRNPREVHKQNDKDRALGRASSAHQTESGMEMDAMEGSSKQIARMVGAS
AMSISQLTGIVVKGSLIDIPVAIAEGMRNTPKLYGEKVPDHAAVTDWKSGITVAATTFVH
QMAEGLTDLVVQPAKGMAKEGIIGFGKGIGKGALQTATKPTAACMGLVGYTGQGIYKSMY
AAVHSKTKHSVASAQRVQDKYSIRAIGLDISKSQVLDEFDRLYRQRSEPGSGSASGNVSL
MGISRTASHVSTQTQPSSATPPILADNKPYSTSPGSP

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	200	524	1.4e-48	0.7774869109947644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.41e-78	102	524	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	6.16e-47	104	523	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.95e-25	104	251	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92276.1|GT1	6.81e-289	7	824	21	858
QKD61343.1|GT1	5.35e-278	51	798	21	789
CEF86870.1|GT1	1.55e-275	53	826	74	863
CEI68149.1|GT1	2.05e-275	53	819	74	854
CZS83364.1|GT1	3.55e-274	53	826	74	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.01e-75	82	590	4	478	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.70e-75	82	590	24	498	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.97e-26	102	517	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.86e-25	102	474	1	337	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	4.76e-19	102	517	1	391	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	4.93e-123	102	526	156	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	2.26e-119	44	531	119	616	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	2.23e-72	87	526	1148	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|P0CN91|ATG26_CRYNB	1.63e-71	101	541	1033	1476	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|P0CN90|ATG26_CRYNJ	1.63e-71	101	541	1033	1476	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999701	0.000332

TMHMM  Annotations     

There is no transmembrane helices in Z517_08982-t43_1-p1.