CAZyme Information: Z517_08918-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_08918-t43_1-p1
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	KN846973|CGC8	71729.04	6.6246

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846973:3977927-3979850(+)

Full Sequence      

MNLEILHRHPSHVQGMLRSRKLLALVLLVGTAVLTLYLLQSPQQIQTLEESTASLFQGHH
AHEENQPLLPASSLLHPIHQLVAQGESDFQTVRARQSRSLSDAVAEYRRRYKLPPPPHFD
KWYNFAKKRGVEPIDEYDTIYHQLLPFWALEPGVIRERTREAIGFDNALISVMIRDGKVT
KAEGGGDMYEWHREATPIMLKDFIKYLPDMDLAFNIHDEPRVVMQHDDLLHHVKVAKDEN
IPKAYNAQRLKNEWSRRAEDLGEGIRIKEYKTTRFNRFAHQPTWSNSRISCPPDSAARSC
LNDSCPDNITAYSNLPLGFVRNTTAFSDICNSPSMERSFGFFDRPNAFDVTHDLFPIFSQ
SKISSFQDILYPSPWYYMGRVKYEPERDMPWEQKAPTMYWRGSTTGGFSRDGGWRRQHRQ
RFLTKIQPLNTAKILELDTNTSAEDSLWREKTISAAEVAHYFDVKFTYIGQCDPGDCDAQ
REYFGTVEPVNMFDALASRYLLDIDGNAFSGRYYAWLLSKSLVYKLAVFREWHDEWLRPW
VHYIPLGLIGDEYAESVRYFDQEEAGKVEGKRIAEQGRNWAQKVLRNEDLEVWYFRLLLE
YGRLIDDDRYNIGFSI

Enzyme Prediction     

No EC number prediction in Z517_08918-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	333	605	2.3e-79	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.11e-23	352	604	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.11e-12	356	604	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	7.24e-258	17	614	1	588
UCK57446.1|GT90	4.18e-252	75	616	84	619
BAE54850.1|GT90	1.68e-251	75	616	74	609
QKX56622.1|GT90	1.68e-244	17	616	298	888
QSZ35850.1|GT90	1.07e-243	76	615	125	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.15e-08	333	612	95	346	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	4.87e-08	356	605	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.76e-45	69	611	146	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	3.50e-08	356	605	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.43e-07	488	605	271	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	2.43e-07	333	612	123	374	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.43e-07	333	612	123	374	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000036

TMHMM  Annotations     

Start	End
22	39