CAZyme Information: Z517_08908-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_08908-t43_1-p1
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		55159.98	4.9251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846973:3955572-3957214(-)

Full Sequence      

MVKDIAPRAGLPADFLWGFATAAYQIEGGATADGRGPSIWDTFCKIPGKIADGSSGDVAC
DSYHRTAQDIELLKKLGAKAYRFSVSWSRVIPLGGRNDPINEAGLQYYVKFVDDLLEAGI
VPFITLFHWDLPDELDKRYGGFLNKEEFVADFANYARVMFKAMGSRVKHWITFNEPFCSA
VLGYNVGVFAPGRSSDRKRCAEGDGSREPWIVGHHILLAHATAVKIYRDEFKSRDGGEIG
ITLNGDWTEPWDPEDERDRTACDRKIEFAISWFADPVYFGHYPESMVKQLGDRLPTFSKE
ESELMKGSNDFYGMNHYCANYIKHKDGPADPLDVGGNLEILFEDKYGNSIGPETQSFWLR
PHAPGFRKLMKWLSDRYGRPKIYVTENGTSIKGENDLSRDEILEDDFRCEYFRSYITSMA
EAVAEDGCDCRGYMAWSLMDNFEWAEGYETRFGVTYVDYENDQKRYPKKSALEISKIFEQ
YIGKI

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	10	479	2.3e-162	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	11	471	5	441	Glycosyl hydrolase family 1.
274539	BGL	9.16e-173	12	472	1	424	beta-galactosidase.
225343	BglB	3.96e-143	11	479	4	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	7.78e-121	4	471	21	473	beta-glucosidase
215455	PLN02849	3.59e-119	4	471	23	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47813.1|GH1	2.40e-290	6	484	4	482
BCS12207.1|GH1	1.68e-288	6	484	4	482
BCS00431.1|GH1	1.68e-288	6	484	4	482
QEV81508.1|GH1	9.31e-288	6	484	4	482
QMW40005.1|GH1	8.47e-284	11	484	9	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	2.78e-280	11	484	26	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	8.56e-241	11	484	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5BWF_A	9.86e-240	3	484	12	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.41e-239	11	484	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
3AHY_A	1.82e-239	11	483	9	471	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	2.05e-201	1	483	1	476	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	6.97e-188	9	482	4	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q0DA21|BGL25_ORYSJ	5.11e-152	8	480	22	496	Beta-glucosidase 25 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU25 PE=2 SV=2
sp|Q9FIW4|BGL42_ARATH	5.75e-151	2	479	12	480	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	1.80e-149	8	471	36	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000075

TMHMM  Annotations     

There is no transmembrane helices in Z517_08908-t43_1-p1.