CAZyme Information: Z517_08780-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_08780-t43_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	KN846973|CGC9	73115.18	10.2000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846973:3602881-3604955(+)

Full Sequence      

MAVGNLVPAAEDDSGVHHQTVTLRPNKKKTFDKRKARAPYRVVEVEKKKPQRTSLFSLVF
TGLNIISISAYLCVLFINIIQTWWRGQGFHRAAYLFALGQFYDNLSSILDGAWRIAVGLA
RDSKPRPTLRILGNNVPGVDVLVVCCGEPDDVVLDTVKAVCKLNWPHDKLRVIVADDGNM
ESLRIQVEKLQGRYPHLYYHARMKPSDGNHGYKAGNLNQTIREYVIDLPGGHNDFIAIFD
ADMMPEPQFLRALIPHALKNEKIGMVTAAQHHYNIPNDDPLNQANSTGTAADDGLRDSVN
VAWCPGSGFIVRKEAWSEIGGFPEFSITEDLITSWFLHGKAWRIVLVHEVLQWGLQPDCI
LTHLKQRRRWWTGHIRDAFKLGFTLWDYRLKEATRLQRIAMLHHSCRPYLMTLTKLANSV
FAFVCLYRGRPVIATPSQNALYWAVMFLAIVRMMALIGDIKSVFGKYYLSVRRRTATGVW
MGHHFSRDVLQTLLPKRLGGLRLGFGVSGVGGTSVKERDINNRPPLVKRLWMLHRREGIL
WHVVLFFIMSYVFIFRIQSEIKASVIDGKFIADKAFWFRFIASAGFPGLGLIETIPLYLT
PVIYAIWPPTMPQRRDSMKYDGKSGLWKPMPEYKSIKWTSAS

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	139	371	1.4e-22	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.20e-81	137	376	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	9.39e-34	137	465	54	367	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133059	CESA_CaSu_A2	7.18e-23	151	373	14	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
236918	bcsA	1.97e-22	137	414	260	529	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	1.53e-21	141	330	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21077.1|GT2	3.33e-97	90	636	231	769
QLI64665.1|GT2	2.11e-96	71	636	189	747
UPK89109.1|GT2	3.71e-95	90	636	284	820
QGI63586.1|GT2	6.74e-95	90	636	264	800
CCT67598.1|GT2	6.74e-95	90	636	264	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	5.49e-21	137	414	273	542	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	2.12e-18	92	450	84	446	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.31e-18	92	450	96	458	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.32e-18	92	450	97	459	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8Z291|BCSA_SALTI	9.78e-22	137	414	273	542	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|Q93IN2|BCSA_SALTY	1.71e-21	137	414	273	542	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|Q7PC70|CSLC2_ORYSI	1.77e-21	121	373	213	468	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC2 PE=2 SV=1
sp|Q69L19|CSLC2_ORYSJ	1.77e-21	121	373	213	468	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC2 PE=2 SV=2
sp|Q9SB75|CSLC5_ARATH	7.13e-21	133	373	223	462	Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999849	0.000148

TMHMM  Annotations     

Start	End
58	80
405	427
442	464
538	557
586	608