CAZyme Information: Z517_07880-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_07880-t43_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		76902.37	6.6814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846973:1119517-1121740(+)

Full Sequence      

MGELARQAKPLQIEDYGLIGDMRTCALVGKNGSIDFMCWPHFDSPSIFANVLDTTEGAGG
HWKISPQSSSVCKQNYRASSNLLQTKWIDEDGVVNLTDFFAVSKHNKVLREKWSGSTLVR
KVECVRGKMSIYIELCPRPDYARDQGFMKISDVQSEEGTYHQTLTWTPNNKDKVGSADIP
EFHASFCTHDRPVSSQPKMFQHVKPGETAASDSKSPLSRARFDLQEGQQIFMIMCNRHVA
PHLTKDLIMNLENDAYRFWTSWVRACLYRGRFQQEVERSMLILKLLTYDPTGAIVAAPTF
SLPEAIGGPRNWDYRYSWVRDASFTVYVFLKMGFPAEAEAYINFIFARIAEWRKKAEASK
GERHHLPLMFGIDGSTSLPELTLDHLGGYQDSVPVRIGNAATDHVQLDIYGELMDSIYLF
NKHGKPISYAQWLDIRYLTDFVCEIWNEPDMSIWEVRGRKQHFTYSKILLWVAVDRALRL
SEKRNFPCPNRNKWLETRDTIYEQVMQKGFNYDMNCFVQSYESNKTLDSAVLIAPLVFFM
SPNDPQFVGTLDRILRTPEKGGLTSAGFVFRYDHEQTDDGVGGREGTFVMCTLWLIESLI
RAAKYDSKYLERAQTMFETVTNFRNHVGMLSEEIALSGEQLGNTPQAFSHLAYVSAAINL
ERVTRGDFEGGFGK

Enzyme Prediction     

No EC number prediction in Z517_07880-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	274	657	2.5e-78	0.9889196675900277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225922	SGA1	6.57e-117	10	665	13	609	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395586	Glyco_hydro_15	3.13e-77	270	657	1	416	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	9.55e-11	278	663	260	616	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA05454.1|GH15	2.06e-246	11	666	18	671
ATZ51652.1|GH15	8.30e-246	11	666	18	671
CAE6998884.1|GH15	4.80e-245	11	662	75	727
QSZ33835.1|GH15	5.07e-244	11	666	18	689
QRC95005.1|GH15	4.18e-243	11	666	104	761

PDB Hits     

Z517_07880-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10211|YAY3_SCHPO	8.27e-188	5	662	11	641	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
sp|A0R0W9|TREH_MYCS2	5.68e-106	13	662	42	650	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
sp|P71741|TREH_MYCTU	1.42e-101	13	662	54	662	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
sp|Q978S7|TREH_THEVO	7.38e-100	12	661	29	611	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1
sp|Q9HLE2|TREH_THEAC	1.97e-93	27	661	2	569	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Z517_07880-t43_1-p1.