CAZyme Information: Z517_07868-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_07868-t43_1-p1
• CAZy Family: GH55|GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699		72328.69	4.2473

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846973:1086876-1089075(+)

Full Sequence      

MLIPREGLLLSLIGGQWISNVYAAITWPSPVYDELEDLMLLTSGYGNRNIMAPLVPCTFA
PNTGHSVAGGFLRVAFHDMAGANVAEGTDGLDASIGFELDSSIFPENTGPAFNNTLSFVS
RFYSSRASISDLLALAAYASVRACGGSAIPLKAGRIDATQAGTPGVPDPKDDIDKLNTEF
ARMGLTPEEGIQLVACGHTLGGVHSAEHPTIVPVGTTSLGVQDFDATNNTFDNSPLTMYL
DGTTLNPLVVGPDVDARSDLRLFNSDGNKTVSSMVDSYDSTCSVILAKMLDTVPASVTLT
EVITPYPVKPANLAVTISSADQLVFSGAIRFWTNKVSKLSVSSLQLVYKDRTGAPAGTID
ASVALGDGTGFDDSFTFYGFNASIPAKTSISSFVVKVSLTSGSTLTYDNNGEDFPVQDTV
LSQNAYSSLAAADSSGSQQATIIAAVRSGTEGEVDLTVDLINAMGANNLPTISKIPTAMT
KVCESLYYDFYSASFGVPAAAVNGTKYDLSAGGEYDGFKGLIGLQAQAARLPCGGGSSST
TSSAMTSSKSRSELLTSTTTASYISTTDTIPDKHVKSTSSPFWSDFTTTKTTSVDQVMST
RGPIWSDWTISTSSSEPVSPETMTSTSDSISWVSGDHGSIPTSGSVPAAAVSSIPAGGSS
SSSSPVSPAVTTFTGTGNALTGSGVVSMFATALGVLLLL

Enzyme Prediction     

No EC number prediction in Z517_07868-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	66	248	2.6e-25	0.6823529411764706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	3.96e-102	27	291	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
395089	peroxidase	2.15e-22	66	204	14	155	Peroxidase.
173823	plant_peroxidase_like	3.07e-17	66	289	16	253	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
173825	ascorbate_peroxidase	4.96e-13	71	242	33	196	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173827	secretory_peroxidase	3.61e-11	66	234	31	229	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57066.1|AA0	2.63e-101	19	512	18	515
VBB76056.1|AA0	3.34e-99	26	518	28	524
QGA18666.1|AA5_1	4.25e-97	6	519	4	522
QRV94524.1|AA2	1.59e-87	9	519	4	523
QRW22025.1|AA2	3.58e-86	2	519	1	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KRJ_A	6.15e-06	105	234	80	201	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.01e-81	18	529	14	513	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.890072	0.109928

TMHMM  Annotations     

There is no transmembrane helices in Z517_07868-t43_1-p1.