CAZyme Information: Z517_07117-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_07117-t43_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		59808.65	5.5643

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846972:3648048-3649964(+)

Full Sequence      

MYPGGNQYLAGTAVDYNYYTVPQTTLNNRILPYHRGRGLGGSSIINGLYYGRGSASVYDH
WVELGNPGWGWDDLYPLSVKQTHFNPPNFKDTFDHSYQTWDPTAYSNGELQIAFQGFVPD
SNVGFIRASEAIGIPIVNELNSGNNTGVKQGTGCFDHRLRRSSSYDAFYKPIQNRTNLDV
LHYASVTSIQFTKGRNGTSRATGVSFTDQPTGQFISVNATKEVIVTMGAFNSPQLLMISG
IGPSGQLSQNGINPVYINENVGQNLNDHCVFSIMALVQQTASTSSMAVNDSTLAAAQQQF
LDSLTGPYTAPSGITNGFQRLSNATLRAIGAQAVLDAGLVNQAHVEFLYESQFYPSGLAF
LPSSGGTSSTGGASSSAYYVPQANLSYISLTASPLVALSRGNVTLKSASIFDAPNIDPNY
YSNETDRAVAINAFKDLRKLLAHPAIAQFTIGPDNGEVQPGIANIPANASDDTIFDYIKT
NTIPNWHASGTCQMLPEADGGVVDSRLRVYGVQNLRVCDVSIIPRLPDVNLQGPVFMIGE
KSAQIIKEDYNLQC

Enzyme Prediction     

No EC number prediction in Z517_07117-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	549	1e-143	0.9172535211267606

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.63e-80	9	549	57	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.27e-74	16	547	63	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.05e-41	399	541	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	9.22e-37	19	546	64	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.58e-33	24	270	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49367.1|AA3_2	1.23e-238	4	551	84	611
QSS67839.1|AA3_2	4.97e-238	4	550	84	610
QBZ60141.1|AA3_2	2.09e-221	3	551	75	607
CCT67729.1|AA3_2	2.77e-218	3	552	75	605
QGI81035.1|AA3_2	2.77e-218	3	552	75	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.12e-59	15	549	59	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.12e-58	15	549	60	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	3.17e-55	11	549	58	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.13e-45	20	552	65	588	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	2.49e-43	10	551	93	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	2.53e-66	12	548	103	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A1CFL2|PATE_ASPCL	5.86e-54	14	543	115	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.67e-51	3	546	92	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.67e-51	3	546	92	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A075TRK9|PATE_PENEN	3.47e-50	14	543	116	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999526	0.000505

TMHMM  Annotations     

There is no transmembrane helices in Z517_07117-t43_1-p1.